(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0256

BA000012.MLL0256     Location/Qualifiers
FT   CDS_pept        complement(182660..183034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0256"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47881"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47881"
FT                   /db_xref="InterPro:IPR009282"
FT                   /db_xref="InterPro:IPR027405"
FT                   /db_xref="UniProtKB/TrEMBL:Q98N80"
FT                   /protein_id="BAB47881.1"
FT                   /translation="MLSGRSAEQPDQPQAPAPVDPAATTASDGGLLGGLGGLLDKLKDA
FT                   GHGNVADSWVGTGQNQAINANDLGAALGPQVIREIAQRTGLDEQELLKQLSAALPGIVD
FT                   KLTPNGQVPQQHQVASAFNS"
     atgctgagcg gcagaagtgc cgaacagccg gatcagcctc aagcgcccgc acctgtcgac        60
     cccgccgcaa ccaccgccag tgatggcggc ctgctcggcg gcctgggcgg cctgctcgac       120
     aagctcaagg atgccggcca cggcaatgtc gccgactcct gggtcggcac cgggcagaac       180
     caggcgatca acgccaacga tctcggcgcc gcactcgggc cgcaggtcat ccgcgagatc       240
     gcgcagcgga ccgggctgga cgagcaggaa ctgctcaagc agttgtccgc cgccctgccc       300
     ggcatcgtcg acaagctgac gccgaacggc caagtgccac agcagcacca ggtggcgtcg       360
     gcattcaaca gctga                                                        375
//

If you have problems or comments...

PBIL Back to PBIL home page