(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0395

BA000012.MLL0395     Location/Qualifiers
FT   CDS_pept        complement(279544..280767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0395"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47984"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47984"
FT                   /db_xref="GOA:Q98MX9"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR026596"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MX9"
FT                   /protein_id="BAB47984.1"
FT                   /translation="MTEASENASATGGVAVVIVAAGRGARAGQANGPKQYQNIGGRAVI
FT                   AHTLEIFLAHPRTDRIVVAIHADDHELFRQAAGSQAERVTAIIGGPTRQESVRLGLLAL
FT                   KEHAPGQVLIHDAVRPFVDADLIDRTISAIGENEGALPALPVADTLKRESAAGVVAETV
FT                   SRSGLHAAQTPQGFPYGPILAAHDKAFQLGRLDFTDDAAIAEWAHIPVKLVPGSPDNVK
FT                   LTWARDIAMAHQRLSSERTHFPDIRTGNGYDVHAFEPGDHVTLCGVAIPHDKKLSGHSD
FT                   ADVGLHALTDALLATCGAGDIGTHFPPSDPQWKGAASRIFVEHAAKVVRQRGGRIANAD
FT                   ITLICEAPRVGPHREAMTAALSRMLGISADRISIKATTNEKLGFVGREEGIAAIATASV
FT                   VFPGEVPE"
     atgactgagg caagtgaaaa cgcgagcgcg acaggtgggg ttgcggtggt gatcgtcgcc        60
     gccggccgcg gcgctcgtgc cgggcaggcc aacggaccca agcaatacca gaacattggc       120
     ggccgcgccg tcattgcgca cacgctggag atatttctgg cccatccgcg aaccgaccgg       180
     atcgtcgtcg ccatccacgc cgacgaccac gaattgttcc ggcaagcggc gggcagccag       240
     gctgagcgcg tcaccgccat cattggcgga ccgacccggc aggagtccgt ccggctcggg       300
     ctgctggcgc tgaaggagca tgcgccgggc caggttctaa ttcacgacgc cgtccgcccg       360
     ttcgtcgatg cggacctgat cgaccgaacc atttccgcca tcggcgagaa cgagggggcg       420
     ttgcccgccc tccccgtcgc agacacgctg aagcgcgaat cggccgccgg agtggtcgcg       480
     gaaaccgttt cccgaagcgg gctgcacgcg gcgcaaacgc cgcaaggttt tccctacggg       540
     ccgatccttg ccgcacacga caaggccttt caactgggta ggctggactt cactgatgac       600
     gcggccatcg ccgaatgggc gcatattcca gtcaagctcg ttccgggctc gccggacaat       660
     gtcaaactca cctgggcacg ggacatcgcc atggcgcacc agcggctttc cagcgaacgc       720
     acacatttcc ccgacatccg caccggcaac ggctacgatg tccacgcctt tgagcccggc       780
     gatcacgtca ctttgtgcgg cgtcgccatt ccacatgaca agaaactgtc cggtcattcc       840
     gatgccgatg tcggcctgca tgccttgacc gacgcgctgc tggcgacctg cggagccggt       900
     gacatcggta cgcattttcc gccgtccgat ccgcagtgga aaggtgcggc gtcgcggatc       960
     ttcgtcgaac acgcggcgaa agtcgtgcgc cagcgcggcg gacgcatcgc caatgccgac      1020
     atcacgctga tctgcgaggc gccgcgcgtc ggcccgcatc gcgaggcgat gacggcagcc      1080
     ctgtcgcgga tgctgggcat ttccgccgac cgcatctcga tcaaggcgac aaccaacgaa      1140
     aaactcggct tcgtcggccg cgaggaaggc attgcggcga tcgccaccgc cagcgtggtg      1200
     ttccccggcg aggtgccgga atga                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page