(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0426

BA000012.MLL0426     Location/Qualifiers
FT   CDS_pept        complement(307339..308505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0426"
FT                   /product="penicillin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48010"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48010"
FT                   /db_xref="GOA:Q98MV3"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MV3"
FT                   /protein_id="BAB48010.1"
FT                   /translation="MQLRAFPPFAGLLGLALLLLCLAPAHAQLFETKATQAFMIDADTG
FT                   TVLFSKDADKPIPPASMAKLMTMEVVFNAIKSGRLKLDDTFVVSENAWRKGGAPSGTST
FT                   MFAKLKSAIRLEDLIQGVTVQAANDGCIVIAEGMAGSEDNFAAQMTERARQIGLKTSTF
FT                   VNSTGLPADGQQTTVRELAQLALHLWRDYPDFYRYYGLKDFTWNKISQKNRNPLLAMDI
FT                   GADGLAVGASEVAGFGIVASVSHNGTRVIMAMNGLANDKERAEEARKLLDWGARSFEKT
FT                   EIFAKDEVVGEAQVFGGAKSGVTLKAKGPIDIFLPITNRDKLTARIVYTGPVAAPVEEG
FT                   QPVGALRVWIGDTLSQETPLFAAESIGVGTLPQRALDAVKELAIGWLR"
     atgcagttgc gcgcctttcc gccatttgcc ggccttctgg gactggcttt gctgctgctt        60
     tgcctcgctc cagcacacgc gcagcttttc gagaccaagg ccacacaggc cttcatgatc       120
     gatgccgaca ccggcacggt gctgttctcg aaagacgccg acaagccgat cccaccggcc       180
     tcgatggcca agctgatgac catggaggtg gttttcaacg ccatcaagtc cgggcgcctc       240
     aagctcgacg acacattcgt ggtcagtgaa aacgcctggc gcaagggcgg ggcgccatcg       300
     ggcacatcga cgatgttcgc caagctcaaa tcggcgatcc ggcttgagga cctgatccag       360
     ggcgtgaccg tgcaggcggc caatgacggc tgcattgtca tcgcagaagg catggccgga       420
     tccgaggaca attttgccgc gcagatgacc gagcgcgccc gccagatcgg gctgaaaaca       480
     tcgaccttcg tcaattcgac cggcctgccg gccgacggcc agcagacaac ggtgcgcgag       540
     ctggcgcagt tggccctgca tttgtggcgc gattatccgg atttctatcg ctactacggg       600
     ctgaaggatt tcacctggaa caagatctcg cagaagaacc gcaacccgct gctggccatg       660
     gacatcggcg ccgacggtct ggctgtcggc gcgagcgagg tggccggctt cggcatcgtc       720
     gcttcggtca gtcacaacgg cacgcgggtg atcatggcca tgaacgggtt ggccaacgac       780
     aaggagcgtg ccgaggaggc gcgcaagctg ctcgactggg gcgcgcgctc gttcgagaag       840
     accgagatct tcgccaagga cgaggtggtc ggcgaggccc aggtttttgg cggtgcgaaa       900
     tccggcgtga cgctgaaggc aaaagggccg atcgacatct tcctgccgat caccaaccgc       960
     gacaagctga cggccaggat cgtctacacc ggcccggttg cggcgcccgt ggaggaaggc      1020
     cagccggtgg gtgcgctgcg cgtctggatc ggcgacacgc tgagccagga gacgccgctt      1080
     ttcgctgccg aatcgatcgg cgtcggcaca ttgccgcagc gcgcgctcga tgccgtcaag      1140
     gaactggcga tcggctggct gcgatag                                          1167
//

If you have problems or comments...

PBIL Back to PBIL home page