(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0428

BA000012.MLL0428     Location/Qualifiers
FT   CDS_pept        complement(310805..311530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0428"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48012"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48012"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MV1"
FT                   /protein_id="BAB48012.1"
FT                   /translation="MVARALSSGMARDPLKVIENRRRYNAKHREELLAKGRSPASLEKQ
FT                   RKRRAENPEKTAEHRRLFKLRHPDRVKAGWKAYRVANSEKIAAYYATYSVEHKAEILAT
FT                   DRVYRAKNRDKVEMWQERRKLKARSISAIRHNPDEVYRVVSRAVSSALPRFMRDDVINS
FT                   MLLAVLEGELLLQNVGARVKDYLGRYNKQYDTFKTLSLDAPMGGADLRRIDLLAAPEPE
FT                   QEEEEDPDIVMLRGGLSRW"
     gtggtagcga gggcgctgtc atccgggatg gctcgcgacc ctttgaaagt cattgagaac        60
     cggcgccggt acaacgccaa gcaccgtgaa gaactcctgg cgaagggacg ctctcctgcc       120
     tccttggaaa aacagcgcaa gcggcgagcc gaaaatcctg agaaaacggc tgaacatagg       180
     cggctgttca agctgaggca cccagaccgc gtcaaggccg gctggaaagc ctatcgcgtg       240
     gcgaatagcg agaagatagc cgcgtactac gcaacctatt cggtcgaaca caaagccgag       300
     atcctggcca cagatcgcgt gtatcgggcc aaaaaccgcg acaaggtcga gatgtggcag       360
     gagcggcgga agctcaaagc gcgatccatc agcgcaatcc gtcacaaccc cgacgaagtc       420
     tatcgtgtgg tgagccgggc ggtcagttcg gcgctgccgc gcttcatgcg tgacgacgtc       480
     atcaactcaa tgctcctggc cgttcttgaa ggcgaactgc tgctgcagaa cgtcggcgct       540
     cgcgtgaagg actacctcgg ccgctacaac aagcaatacg atacgttcaa gacgctctcc       600
     ctggatgcgc caatgggagg cgcagatcta cgtaggattg acctgttggc ggcgccagag       660
     ccggaacagg aagaggaaga agaccctgat atcgtaatgc tcagaggtgg actctcacgc       720
     tggtaa                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page