(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0443

BA000012.MLL0443     Location/Qualifiers
FT   CDS_pept        complement(320053..321102)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0443"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48026"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48026"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MT7"
FT                   /protein_id="BAB48026.1"
FT                   /translation="MPMPRDGSGVMSWPPNGNAVTATPIDSSKYNARFADLLSDLNAAR
FT                   PITAGGTGANTAIGGNDNLNTAGANIASASTVNLASATGVAVTITGVARINSFGTAAAG
FT                   VERVLTFAGVLPLTYNATSMILPGAADIVTAVGDVGTFRSLGGGNWRCVSYETADGQPI
FT                   SSTFTSSQTFNAGLAANNSTGQAIGVLAGPAATATLFYGHALAGAGNAAFITLDRPGSF
FT                   AANFGIDTDNKWKVGGFSMGANAYEIVHMGNYTTLLDPRYFQTANFASTLAGLAVGAVG
FT                   TSALLGANPAADLSPGNTVAGSNLRFTHAGGFVGSGATAPSGTWRAMGNTTSAGFNTSA
FT                   GATVFLRIS"
     atgccaatgc cccgtgacgg ctctggagtt atgtcgtggc cgccgaacgg caatgccgtc        60
     acggcaacgc cgatcgacag cagcaaatac aatgcccggt ttgcggattt gctatcggac       120
     ctgaatgctg cccgaccgat taccgcaggc ggcaccgggg cgaataccgc catcggcggc       180
     aacgacaatc tgaacaccgc tggcgcgaat atcgcctcgg catcgaccgt caatctggcc       240
     agtgcgaccg gggtcgcggt cacgataacc ggggtggcta ggatcaacag ctttggcacg       300
     gcagcggccg gcgtcgagcg cgttctgacc ttcgcgggcg tccttccgct gacctacaat       360
     gctacgtcca tgattttgcc aggcgccgcc gacatcgtca cggctgttgg cgatgtcggc       420
     accttccgct cgcttggcgg cggcaattgg cgctgcgttt cctacgagac ggcggacggc       480
     cagccgattt cgagcacctt cacctcgtcg caaacgttca atgctggtct ggcggcaaac       540
     aacagcaccg ggcaggccat tggcgttttg gcgggcccag cggcgacggc gaccctgttc       600
     tacggccacg cgcttgccgg ggcgggtaac gcggccttta tcactctcga ccgaccgggc       660
     tcctttgccg cgaatttcgg catcgatacg gataacaagt ggaaggtcgg cggcttttcc       720
     atgggcgcga acgcctatga aatcgtccac atgggcaact acacgaccct gctcgacccg       780
     cgctatttcc agacagcgaa cttcgcctca acccttgccg gcttggcggt gggtgctgtc       840
     ggaacctcag cccttttggg tgccaacccc gcagcggacc taagccctgg caacactgtc       900
     gctggcagca atcttcgctt cacccatgct ggcggtttcg tcgggtcggg ggcgaccgcg       960
     ccgtccggca cttggcgggc catgggtaac accaccagcg ccggtttcaa cacctccgct      1020
     ggcgctacag ttttcttgag gatttcgtga                                       1050
//

If you have problems or comments...

PBIL Back to PBIL home page