(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0446

BA000012.MLL0446     Location/Qualifiers
FT   CDS_pept        complement(321579..323684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0446"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48028"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48028"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MT5"
FT                   /protein_id="BAB48028.1"
FT                   /translation="MAQLVPVDTDPFATTPAAAAPVAVPAQASPALVPVDHDPFAGTNQ
FT                   PPGVPVYVPPGVKGYDPQTGEVAPGQYTTGNDLGLAFTSSVLNGVPIVGPYLKQGAESL
FT                   GAKVNSALSGKSEADVRYASDQATNRAVNDNPYTAGSGNIVGAVAGTLPAVVAAPELFG
FT                   AGEAGLGMRSVVSALTGGTINAADSGVRSGGDPAAMERRGLIGAGFGLIAPGGGTLIGK
FT                   GIGSAVDYLTRPGASELGNFSRATLAKITGAMNADGLTPQAVQQRLTRLGPDAMLADAG
FT                   PNLQQTAAGLVAKPGEARGIIQDAIAQRDAGANQRIRSTLDSELGPAPVPSQINAGITA
FT                   NQAALSPEYRVALQNAGPVDTLPIARYLDQDIQTLRGEPQRVLQRVRAMLDHVPTPQEI
FT                   AQARALGQPPPGNSLVTDAGELLNARHAVDDMLQTTQGSNALNALSTARQAIDDELRAS
FT                   VPGIKEVDAKYSELARQRDAVQRGQTVLSSGRESPRPAELAQEVQQGAQPQGMQVGPSA
FT                   VPVRLREGARAEIERIVGTNLNDRVALQGLIKGQGDWNPQRLATLFGQDKAQRLLDVLD
FT                   AERTFANTSNFVTKNSATAARLQAVKSLDGGDVPGLGMVDSYKAGGLLGLGRAGALKGL
FT                   GPVVEAIRSKGANAANSALARGLVSGDHDAVVKALIAASPVPIPTKAISKVAEALLLGS
FT                   GSAAMRP"
     atggcccagc ttgtcccggt cgacaccgat ccctttgcaa cgacaccggc cgccgcggcg        60
     ccggtagccg tgccggcgca ggcttcgccg gcccttgttc cggtcgacca tgatccgttt       120
     gccgggacga accagccgcc gggcgtgccg gtctatgttc cgcccggcgt caaaggctat       180
     gacccgcaaa ctggggaggt cgctccgggg cagtacacga cgggcaacga ccttgggctt       240
     gcgttcacgt cgtcagtcct caacggcgtc cctatcgtcg ggccatatct gaaacaggga       300
     gcagaaagcc ttggtgccaa agtcaactcg gcgctgtctg gcaagtcgga ggcggatgtt       360
     cggtatgcat ccgatcaggc cacaaaccgc gctgtaaacg acaatcctta cacggccggc       420
     agcggcaata tcgtgggtgc tgttgcaggc acgttgcctg ccgtcgtcgc tgctccggag       480
     ctgttcggcg cgggtgaagc tgggcttggt atgcgctcag ttgtcagcgc gttgacaggc       540
     ggcacgatca acgccgccga ttccggggtg cgctcgggcg gcgatcctgc tgcgatggaa       600
     aggagaggtt tgatcggtgc aggtttcggc ctgatcgccc caggcggcgg cactctgatt       660
     ggaaagggca tcggcagcgc ggtcgactat ttgacccggc ctggtgcatc ggagcttggc       720
     aacttctcgc gggcgacact tgccaagatc accggggcga tgaacgcgga cgggctcacg       780
     cctcaagccg tacagcagcg gcttacccgg cttggccctg acgccatgct tgccgatgct       840
     ggtccgaacc ttcagcagac ggccgccggc cttgtggcga agcccggaga ggcgcgcggc       900
     attatccagg atgctatcgc gcagcgagat gcaggtgcga accagcgcat ccgaagcacg       960
     ttggatagcg aacttggccc tgcgccggtt ccatcccaga tcaacgctgg catcactgcg      1020
     aaccaggccg cgctttcgcc agagtaccgg gtcgcccttc aaaacgctgg cccggtcgat      1080
     accttgccga tcgcgcgata tctcgaccag gacattcaga cgttgcgggg cgaaccgcag      1140
     cgcgtcttgc agcgcgtccg tgccatgctg gaccatgtgc cgaccccgca agagattgcc      1200
     caggctcgcg cccttggcca gccgccgccc ggcaactctc tggtgactga tgccggcgag      1260
     ttgctgaacg cccggcacgc tgtcgacgac atgttacaga ccacccaggg gtcaaacgcc      1320
     ctgaatgcgc tttcgaccgc gcgacaggcg atcgatgatg agttgcgcgc atcggttcct      1380
     ggcatcaagg aagtcgatgc gaaatattcc gagcttgccc gccagcgtga tgcggttcag      1440
     cggggccaga cggtgctttc cagcggccgg gagtccccaa ggccggcgga actcgcgcaa      1500
     gaggtccagc agggcgctca gcctcaggga atgcaggtcg gcccctccgc agtacccgtc      1560
     cggctccggg agggcgcgcg ggccgaaatc gagcgcatcg ttggcacgaa cctgaacgac      1620
     cgtgttgcgc ttcagggctt gatcaagggt caaggtgact ggaacccgca aaggctggct      1680
     acgctgttcg ggcaagacaa ggcgcagcgc ttgctcgatg tgctcgacgc cgaaaggact      1740
     ttcgccaaca ccagcaactt cgtcacgaag aactcggcga ccgccgcgcg tctccaggct      1800
     gtgaaaagcc ttgacggcgg cgatgtgccc gggctcggca tggtcgacag ctacaaggcc      1860
     ggcggtctgc tgggattggg tcgcgctggc gcgctgaagg gcttgggccc ggtggtcgaa      1920
     gcgatccgca gcaagggagc aaacgcggcc aattcagcgc tcgctcgcgg tctcgtttca      1980
     ggagatcacg acgctgtggt taaggcgctg atcgctgcga gcccggtacc gatcccgaca      2040
     aaagcgattt cgaaggtcgc agaggctctg ttgctcggtt ctgggtcggc ggcgatgcgt      2100
     ccgtga                                                                 2106
//

If you have problems or comments...

PBIL Back to PBIL home page