(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0455

BA000012.MLL0455     Location/Qualifiers
FT   CDS_pept        complement(330878..331420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0455"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48035"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48035"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MS8"
FT                   /protein_id="BAB48035.1"
FT                   /translation="MAYVPHTPYLGLPPIASTIAPTASTLSLGRGSPGPWLGDIITAQD
FT                   PVYGVGEFIYLLGVAGTIVGSLVTFDGANAGTPTWQTALAPSTANLNAPLAVAMSANVA
FT                   GQYGWYQLFGSAVVATNGTLAAGPGPVYLAGSGQVTSTQANGKQVVNARNETATGTPAA
FT                   GLAVVKINYPYAQGQIV"
     atggcttatg ttccgcacac tccgtatctc ggccttccgc cgatcgcttc caccattgcc        60
     ccgacggcga gcacgctttc cctcgggcgc ggctctcctg gcccttggct cggcgacatc       120
     atcacggcac aggatcccgt gtatggcgtc ggcgagttca tctatctgct cggcgtcgcc       180
     ggcactatcg tcggttccct cgtcaccttt gacggcgcca acgccggcac gccgacctgg       240
     cagacggcgc ttgcaccgtc gaccgccaac ctcaatgcgc cgctcgcggt tgccatgtcg       300
     gcaaacgtgg ccgggcagta cggctggtat cagctcttcg gctcggcggt cgttgcaacc       360
     aacggcacgc tcgccgctgg tcctggcccg gtctatctcg ctggctccgg ccaggtgacg       420
     tctacccagg cgaacggcaa acaggtggtc aacgctcgca atgaaacggc aaccggcacc       480
     ccggcggccg gcctggcggt cgtcaagatc aactacccct atgcgcaggg tcagatcgtc       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page