(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0457

BA000012.MLL0457     Location/Qualifiers
FT   CDS_pept        complement(331433..332449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0457"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48036"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48036"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MS7"
FT                   /protein_id="BAB48036.1"
FT                   /translation="MALTSVEKNQEILSLALEDRSQGYQDLVSNSCALLHVLQSKGNFR
FT                   EYSGPRIRERLLYTKTGSAVWYNGFGFLNPVPTELFNDAEYTPKMCAVAVTLSNEDILN
FT                   NEGENQIMDMMESHIAAAESELEDEVDISLHGNGTRFGGRELGGMQLAVPTVNNSGTYG
FT                   GIDRGANAIWRTSSFDANSFAVDIGTQVTATTVRPMLNRIMTQRARGKKAADMLLMSGE
FT                   HYAAYDAATVAIQRVNDTNALGKLGFTSLKYYGAGRSADIVLEGGIGSNMPANTTYGLD
FT                   TDNLRVRYHPERNFNKIGKAMVPINQDAVVQYIGFMGELTMVNPLFQWKFFDSNPAA"
     atggctctta cttcagtcga aaaaaatcag gaaattctgt ccctggccct tgaggatcgc        60
     tcgcaaggct accaggacct tgtttccaac tcgtgcgcgc ttctgcacgt gcttcagagc       120
     aagggcaatt tccgggagta ttccggcccg cgcatccgtg agcgtcttct ctacacgaag       180
     acgggatcgg cggtctggta caacggtttc gggttcctca acccggtgcc caccgagctg       240
     ttcaacgacg ccgaatacac gccgaaaatg tgtgcggtcg ccgtcaccct ctccaacgag       300
     gacatcctga acaacgaggg cgaaaaccag atcatggaca tgatggagtc ccacatcgca       360
     gccgccgaaa gcgagctgga agatgaggtc gacatctcgc ttcatggcaa cggcacccgc       420
     ttcggcggcc gtgagctggg cggcatgcag ttggcggttc cgaccgtgaa caactccggc       480
     acctatggcg gtatcgatcg cggcgccaac gccatctggc gcacgtcgtc gttcgatgcg       540
     aattcgttcg ctgtggacat cggcacccag gtgacggcga ccacggtccg cccgatgctc       600
     aaccgcatca tgacgcagcg cgcacgcggc aagaaagccg ctgacatgct gctgatgtcg       660
     ggcgagcact acgcggccta tgacgcggcc accgtcgcca tccagcgcgt caatgacacg       720
     aacgccctcg gcaagctggg cttcacgtcg ctgaaatact acggcgccgg tcgctcggcc       780
     gacatcgtgc ttgaaggtgg catcggctcc aatatgccgg cgaataccac ctatggactg       840
     gacaccgaca atcttcgtgt ccgctaccac cccgaacgca acttcaacaa gatcggcaag       900
     gcgatggtcc cgatcaacca ggacgccgtg gtccagtaca tcggcttcat gggcgaactg       960
     accatggtca atccgctgtt ccagtggaag ttcttcgaca gcaatccggc cgcttaa         1017
//

If you have problems or comments...

PBIL Back to PBIL home page