(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0462

BA000012.MLL0462     Location/Qualifiers
FT   CDS_pept        complement(335535..337919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0462"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48041"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48041"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MS2"
FT                   /protein_id="BAB48041.1"
FT                   /translation="MIDDDQDAIDTIDDAVDPSLKLKSSKGWLKLITDQEKAGYSDYQE
FT                   KCTNIEKQYADLAKLASVTRDRQFQIFWANIEVLKPSMYSRPPVPAIVPRFQDRSPIPR
FT                   TASEMLERSAAVALQREDIDSVMRQVRDDLAILARGCIWVRYETRSKDNDYTEKVCIDH
FT                   KNRRDFAHDPAREWKEVDWVAGGAWMTKKEMRKRFRSTSGDAYMNAEFATRKDDKNNSD
FT                   GKLKARVWEVWCKSQNKVVWVSPGVDVLLDEGEPHLTLEGFFPCPRPAFGTVQRNSLIP
FT                   VPDFVFYKDQIEEVNDITNRISALSDALRVRGFYPAGAGEIGDAIEAALKSTNDRQIMV
FT                   PVSNWAMLGGSAKDMIVWLPLDMVVQTITQLIQLRKQLIEDIYQISGLSDIMRGETNPN
FT                   ETATAQNIKTQYGSVRIRDRQAELVRIALDTVRIIVEIMAENFKPDTLQEMSLMELPTD
FT                   ADVAKVVKGLENQAQQIVAELQHAKTDPEVQQMAQQNPDAAKQIMDQAQQQVQALSKQV
FT                   DDQKATVTIDQVIKFLRDQKIRAFSLDIETDSTIQPDEQAEKASRAEFLTALAGVLAQL
FT                   GPMVEARPETAPFAAELLKFAIAPFRVGRQMDTAIDEFADNMKAAAAQAKPPPPDPAML
FT                   KAQAEIQALQAKSEAEAQSHAQEHAYKMQTLAAERDVKVQEAQIRVGNENARHARDMQV
FT                   KDADMRSKLAEAGYPPDFSIDGANQMNQAQFQQIMAELTATREQSVQQGQQLGQTLVQA
FT                   LQLVVQSNQDTAKAMIAAATAPKRIVRDHAGRPIGAETVMQ"
     atgatcgatg acgaccaaga tgcgatcgac actatcgacg atgcggttga tccgtcgctg        60
     aaactgaagt cctcaaaggg ctggctgaaa ctgatcacgg atcaggaaaa ggccggctat       120
     tcggactatc aggagaaatg caccaacatc gagaagcagt atgccgacct ggccaagctc       180
     gccagcgtca cgcgcgaccg acagtttcag attttctggg ccaacatcga ggtcttgaag       240
     ccgtcgatgt attcccggcc acccgtgccg gccatcgtcc cacggtttca ggatcgcagc       300
     ccgatcccgc gcaccgcttc tgagatgctg gagaggtcgg cagccgttgc gcttcagcgt       360
     gaggacatcg acagcgttat gcgccaggtc cgcgatgacc tggccatcct cgcccgagga       420
     tgcatctggg tgcgttacga gacccggagc aaggacaacg actataccga aaaggtctgc       480
     atcgaccaca agaaccgccg cgatttcgca catgatccgg ctcgcgagtg gaaggaagtc       540
     gactgggtag ctggcggcgc atggatgacg aaaaaggaaa tgcgcaagcg tttccgcagc       600
     acgtccggcg atgcctacat gaacgccgag tttgctaccc gcaaggacga caagaacaat       660
     tccgacggca agctgaaggc tcgcgtctgg gaagtgtggt gcaagtcgca gaacaaggtg       720
     gtgtgggtct cgcctggcgt cgatgtgctg ctcgacgagg gcgaaccaca tctgacgctg       780
     gaaggcttct tcccgtgccc acggcctgcc tttggcacgg tgcagcgcaa cagcctgatc       840
     ccggtccctg atttcgtctt ttacaaggac caaatcgagg aagtgaacga catcacgaac       900
     cgcatttcgg cgctgtccga tgcgttgcgc gttcgtggtt tctatccggc cggcgctggc       960
     gagatcggcg atgccatcga ggcggcgctg aagtcgacca acgaccggca gatcatggtg      1020
     ccggtcagca actgggccat gcttggtggc agcgcgaagg acatgatcgt ctggcttccg      1080
     ctggatatgg tggtgcagac catcacccag cttattcagc ttcggaagca gttgatcgaa      1140
     gatatctatc agatcagcgg cctttccgac atcatgcgcg gcgagaccaa tccgaacgag      1200
     acggcgaccg cgcagaacat caagacccag tacgggtcag ttcgcatccg cgaccggcag      1260
     gccgaacttg ttcgcattgc gctcgacacg gtgcgcatca tcgtcgagat catggccgag      1320
     aatttcaagc ctgatactct gcaggaaatg agcctgatgg aattgccgac cgacgccgac      1380
     gtggcgaaag tcgtcaaggg attggagaac caagcccagc agatcgtcgc cgagcttcag      1440
     cacgccaaga cggaccccga agtccagcag atggcgcagc aaaacccaga tgctgccaag      1500
     cagatcatgg accaggcgca gcagcaggtt caggcgctca gcaaacaggt cgacgaccag      1560
     aaagccaccg tcaccattga ccaggtgatc aagtttcttc gggaccagaa gattcgggcg      1620
     ttcagcctcg atatcgagac cgacagcaca atccagcccg acgagcaggc cgaaaaagcg      1680
     agccgagcgg aattcctgac ggcgcttgcc ggtgtcctgg cccagctcgg ccctatggtc      1740
     gaggcaaggc cggaaacggc acctttcgcg gccgaattgc tcaagttcgc aatcgcaccc      1800
     ttccgtgtcg gccgccagat ggataccgcg atcgacgagt ttgccgacaa catgaaggcg      1860
     gcagccgcgc aggccaagcc gccgccgccg gatcctgcga tgctcaaggc ccaggccgaa      1920
     atccaggcgt tgcaagcgaa atctgaggcc gaagcgcaat cgcatgcgca ggagcacgcc      1980
     tacaagatgc agacgctggc ggccgagcgc gacgtgaagg tgcaggaagc gcagatccgc      2040
     gttggcaacg agaatgcccg acatgcccgt gacatgcagg tcaaggatgc cgacatgcgg      2100
     tcgaagctgg ccgaggccgg ttatccgccc gacttctcga ttgatggtgc aaaccagatg      2160
     aaccaggcac agtttcagca gatcatggcc gagctgaccg ccactcgcga gcagtcggtg      2220
     cagcaaggac agcaactcgg ccaaacgctg gtgcaggctc tgcaactggt cgtgcaatcc      2280
     aaccaagata cggcaaaagc tatgattgcg gccgccacgg cgcccaagcg cattgtgcgc      2340
     gaccatgcgg gccgtccgat tggcgctgaa acggtgatgc aatga                      2385
//

If you have problems or comments...

PBIL Back to PBIL home page