(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0469

BA000012.MLL0469     Location/Qualifiers
FT   CDS_pept        complement(343274..343600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0469"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48048"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48048"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MR5"
FT                   /protein_id="BAB48048.1"
FT                   /translation="MSDEQQAQMPLDLSTVEPSEPDQTATKPRKTNPWTMDWDDGEEIV
FT                   VNNQSAIAVYTNQKLGIVIRQERTWDEEEDTLIILSTPGAAYRVIEAIQRELEANKERK
FT                   KNGG"
     atgagcgacg aacagcaagc ccagatgccg ctcgacctgt ccacggtcga gccgagcgaa        60
     cctgatcaga ccgccaccaa gccgcggaag actaatccat ggacgatgga ttgggacgac       120
     ggagaggaga ttgtcgtgaa caaccagtcg gcgattgccg tctacaccaa tcagaagctg       180
     ggcattgtga tcagacagga acgcacttgg gacgaggaag aggacacgtt gatcatcctg       240
     tcgacaccag gcgcagcgta tcgggtgatc gaagcgatcc agcgcgaatt ggaggcgaac       300
     aaggagcgca agaaaaatgg cggctag                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page