(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0476

BA000012.MLL0476     Location/Qualifiers
FT   CDS_pept        complement(348772..349311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0476"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48056"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48056"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MQ7"
FT                   /protein_id="BAB48056.1"
FT                   /translation="MFPISALIGFEKDGQWRGALALAGEAMAQTAEDNFRIEVWDREEK
FT                   NLVETICRSPDSFISQAAWQAAIRRRPGMVLIHYNSRHVMEKIITPGEPKVPPQTIVDG
FT                   SVHAGQDVALGDLREWHKLRAWCKNCSHHAEVKPAALIKRYGEAALFSTVERALFCTGC
FT                   DRGGPVRLEIHKLPRN"
     atgttcccta tctctgcctt gatcggcttt gagaaggatg ggcaatggcg aggcgctttg        60
     gcgctggccg gcgaagctat ggcacagacg gcagaggaca atttccgtat cgaggtttgg       120
     gaccgcgagg agaagaacct cgttgagacc atctgccgat ctccagattc tttcatcagc       180
     caagcggcgt ggcaggcggc tattcgtcgt cgtcccggaa tggtgctgat ccactacaac       240
     agccggcatg tgatggaaaa aatcatcacg ccgggcgagc cgaaagttcc gcctcagacc       300
     atcgttgatg gcagcgtgca tgccggccaa gacgtggcgc ttggcgatct gcgcgaatgg       360
     cacaaactgc gcgcgtggtg caagaattgt tcgcaccatg ccgaggtgaa gcccgccgcg       420
     ttgattaagc gctacggcga ggccgcgctt ttcagcacgg tagagagagc gctattttgc       480
     accggttgcg atcgaggagg gccggtcagg ttagaaatcc acaaactgcc gaggaattaa       540
//

If you have problems or comments...

PBIL Back to PBIL home page