(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0485

BA000012.MLL0485     Location/Qualifiers
FT   CDS_pept        complement(355481..357823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0485"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48063"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48063"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MQ0"
FT                   /protein_id="BAB48063.1"
FT                   /translation="MRDGSSVRLPPELLPYRQFVVWRLEQKPGSPKPAKMPYSANGGRA
FT                   DTTNPATWSDYPTAVRALASGQYAGIGFVFAENDPFFVIDLDGCRDATTGELSAEAAAI
FT                   TRMFPNAAWELSQSGEGIHIFGRCDKVALGGFRNKWAGWCEFYRTKRFVAFGPGGIQGN
FT                   IDIDWTNQLAILVPARGVGEQDASQEAVERDPRWIGPDDDEELLRRFLASTGGTKAKLQ
FT                   ASPTNLQLWEAHAAALAQYFPSATGKPFDHSSADQALANVLAFWTGRDYGRIIRLFGRS
FT                   ALGRREKWTRRAAYRNSTVNAAVRSCQTVYGGNGQERRSRQVQENVRIGSDIGADIHTR
FT                   VMTLEDMLQDLWFIRHSKSGGAIADSRTLNVLPFATAQREYSASRYEVAASTIDPKTGD
FT                   FKKRYLPVFNQWEQSPSRKSVDVITWKPNGAVICEAPESQGAGFNTWRGFQPYRLPDGS
FT                   QSLVEVWSEHLAYLIPIEAERVRFEQWLAHIVQRPEELPQSAYLFITEETGIGRNWLSS
FT                   VLVRVLRGYVAAGIDIQEMLDGTFNGRLSRKLLAVVDEAKAGMQGYGRWSHSEKLKSMI
FT                   NPEMRRINEKHGLEFVEWNCCRWLFFSNNWDALPFDASDRRFNVVANPTHRQSPDYYER
FT                   IYSQIANPDFISAVRKRLELLDISGFKPGAIPDMNEAKRKALGAMASDLDNLLAAFRDE
FT                   WPGPLAERSDVINYLHVSIAKLPGEKTINKLIEQAGMKLVERISIGPNKYRFVVVRDYT
FT                   AQQIETNPQWAYAEAVNARGKYGFRQG"
     atgcgtgacg gaagttccgt caggctccca cctgaattgc tcccatatag gcagttcgta        60
     gtttggagat tggagcaaaa acccggctcg cccaaacccg cgaagatgcc ttattcggcc       120
     aatggtggaa gggcagatac gaccaacccc gccacatggt ccgattatcc aacggctgtt       180
     agagcgctgg cgtccgggca gtatgccgga attggatttg tctttgccga aaacgatcca       240
     ttttttgtga tcgatctgga tggatgtaga gacgccacga ctggtgagtt gtcagccgaa       300
     gccgctgcca taactcgaat gtttccgaac gctgcatggg agctaagtca gagcggcgag       360
     gggattcaca tattcgggcg atgcgacaag gtggcgcttg gtgggtttag gaacaagtgg       420
     gccggctggt gcgaatttta ccgaactaag cggttcgtcg cttttggtcc gggtggcatt       480
     caaggcaaca tcgatatcga ctggacgaac cagttagcga tcctcgttcc agctcgcggg       540
     gttggcgagc aagacgcctc tcaagaggcc gtagagcgcg atccgcgctg gatcggtcca       600
     gacgacgacg aagagctgtt gcgccgcttc ctcgcctcca caggcggcac aaaggccaag       660
     ctccaggcat cgccgacgaa cctccaactg tgggaggctc acgcggcagc gcttgcgcaa       720
     tattttccat cagcgacagg caagcccttc gatcattcga gcgcagatca agctttggca       780
     aatgtcttgg ccttttggac cggtcgcgac tatgggcgga tcatccgact gttcggtcga       840
     tccgcactag gcaggcggga gaaatggaca cgtcgcgcgg cctacagaaa ctcgaccgtc       900
     aatgccgcag tacgatcctg ccaaaccgtc tacggcggca acggtcaaga acgtcgctcc       960
     cggcaggtcc aagagaacgt ccgaatagga agtgatattg gggccgatat ccacactcgc      1020
     gttatgacgc ttgaggatat gcttcaggac ctttggttca tccgccacag caaatcgggc      1080
     ggagcgattg ccgattccag aacgctcaac gttctgccgt ttgccacggc acaacgtgaa      1140
     tactcagctt cccgatatga agtcgccgcc agcacaattg acccgaaaac cggcgacttc      1200
     aaaaaacgct atctgccggt gttcaaccag tgggagcaat cgccatcaag gaagagtgtc      1260
     gacgttataa cttggaagcc gaacggagct gtcatctgcg aggcgccaga aagccaaggg      1320
     gcagggttca acacttggcg cgggtttcag ccgtatcgct taccagatgg ctctcagtca      1380
     cttgtggagg tttggagcga gcatctggcc tacctcatcc cgattgaggc ggagcgcgtt      1440
     cgtttcgagc aatggcttgc gcacattgtc cagcgtccgg aagagcttcc tcaatctgcc      1500
     tatctcttca tcacggagga gacgggaata ggccgcaact ggctatcgag cgtccttgtc      1560
     cgagttctgc gcggttatgt ggctgccggc atcgacatac aggaaatgct ggatggaaca      1620
     ttcaacggtc gattgagccg aaaattgctc gccgtcgtgg atgaagccaa agcaggaatg      1680
     cagggatatg gtcgctggag ccacagtgaa aaactaaagt cgatgatcaa tccggaaatg      1740
     cgccggatca acgaaaagca cggcttggaa tttgtcgaat ggaactgctg tcgatggctc      1800
     ttttttagca acaattggga cgcacttccg ttcgacgctt cggaccgacg gttcaacgtc      1860
     gttgccaatc caacgcacag gcaatcgcct gactactacg agcgaattta tagccagatt      1920
     gccaatccgg actttatctc cgccgtgcgc aagaggttgg agcttttgga catatcgggg      1980
     ttcaaacccg gcgctattcc cgacatgaac gaagctaagc gcaaggccct cggcgcgatg      2040
     gcttccgact tggacaattt gctcgcagca ttcagagacg aatggccggg accgttggca      2100
     gagcgcagcg acgtcatcaa ttatctacat gtgagcatcg ccaaactgcc cggcgagaaa      2160
     acgatcaaca aattgatcga acaagcgggg atgaagctag ttgagcgaat ttcgatagga      2220
     ccgaacaaat atcgcttcgt cgtcgtgcgg gactacaccg ctcagcaaat cgaaacaaat      2280
     ccacagtggg catacgccga agcggtgaac gctcgcggaa aatatggctt cagacagggt      2340
     tag                                                                    2343
//

If you have problems or comments...

PBIL Back to PBIL home page