(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0486

BA000012.MLL0486     Location/Qualifiers
FT   CDS_pept        complement(357816..358046)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0486"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48064"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48064"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MP9"
FT                   /protein_id="BAB48064.1"
FT                   /translation="MECVAMAGNLRVREMNQSAIVLSIPQVCATLGISRPTLDRYIKDN
FT                   PSFPRKKKIGPRLVGFLRSDIETYIGSLPDA"
     atggagtgtg tggccatggc aggaaatctg cgcgtccgcg aaatgaacca atctgcaatc        60
     gtgctgtcga tcccccaggt ttgcgcaacg cttgggatta gccgtccgac gttggaccgg       120
     tacatcaagg acaatccgtc ttttccgagg aagaagaaga tcggtccgag gctggttggc       180
     ttccttcgaa gcgacatcga aacttacatt gggagccttc cggatgcgtg a                231
//

If you have problems or comments...

PBIL Back to PBIL home page