(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0502

BA000012.MLL0502     Location/Qualifiers
FT   CDS_pept        complement(369657..370577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0502"
FT                   /product="permease protein of sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48076"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48076"
FT                   /db_xref="GOA:Q98MN7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MN7"
FT                   /protein_id="BAB48076.1"
FT                   /translation="MDITVNILLTIATAATPLLIAAIGELVVERSGVLNLGVEGMMIMG
FT                   AVGGFGAGYLTGSPWIGLLAAIAMGALFSLLFAVMTLSLATNQVATGLSLTLLGLGLSG
FT                   MIGTSFVGQPGVRLPNLDIPGLSSIPVVGKLLFGQDPVFYISIVLTAAVMWFLFKTRTG
FT                   LTLRSIGDSHTSAHALGIKVIRYRYLAVIFGGACAGLAGGHLSLVYTPQWVENMTAGRG
FT                   WIALALVVFASWRPWRVLAGAYIFGAVWIGQLHAQAFGIPVPSQMLSSLPYLATVVVLV
FT                   LISRNKRLTMMNTPASLGQPFVPDR"
     atggacatca ccgtcaacat cctcttgacc atcgcaacgg ccgcaacgcc gcttttgatc        60
     gcggcgatcg gcgaactggt ggtcgagcgc tccggcgtgc tcaatctcgg cgtcgagggc       120
     atgatgatca tgggcgcggt cggcggcttc ggggccggct acctgaccgg ctcgccctgg       180
     atcggcctat tggcggcgat cgccatgggg gcgttgttct cgctgctgtt cgccgtcatg       240
     actctgtcgc tggccaccaa ccaagtggcg accggcctgt cgctgacgct gctcggcctc       300
     ggcctctccg gcatgatcgg cacgagcttc gtcggccagc ccggcgtcag gctgcccaat       360
     ctcgacattc ccggcctgag ctccatcccg gttgtcggca agctgctgtt cggccaggat       420
     ccggtgttct acatctcgat cgtgctgacc gccgccgtca tgtggttcct gttcaagacg       480
     cgaaccggac tgacgctgcg ctcgatcggc gacagccaca cctcggcgca tgcgctcggc       540
     atcaaggtca tccgctaccg ctatttggcg gtgatcttcg gtggcgcctg cgccggtctc       600
     gccggcggcc atctgtcgct ggtctacacg ccgcaatggg tcgagaacat gaccgcgggc       660
     cgcggctgga tcgccttggc gctcgtcgtg tttgcgtcgt ggcggccgtg gcgggtgctg       720
     gccggcgcct acatcttcgg cgcggtgtgg atcggccagc ttcatgcaca ggcttttggc       780
     attccggtgc cctcgcagat gctttcttct ctgccctatc tggcaaccgt cgtggttctc       840
     gttctaatct cgcgcaacaa gcgtctgacg atgatgaaca cgccggcatc cctggggcag       900
     ccattcgttc cggatcgttg a                                                 921
//

If you have problems or comments...

PBIL Back to PBIL home page