(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0540

BA000012.MLL0540     Location/Qualifiers
FT   CDS_pept        complement(399006..399359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0540"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48106"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48106"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MK7"
FT                   /protein_id="BAB48106.1"
FT                   /translation="MTAPKELRVSKDRKLLSVTFPNHQPFELPAELLRVASPSAEVQGH
FT                   SPDQRVTVPGKRNVAILKIEPVGNYAVRITFDDFHDTGIFTWNYLHTLGHEKDERWNAY
FT                   LAELAEKGLSRDR"
     atgaccgcgc caaaagaact ccgggtctcc aaggaccgca agctgctgtc ggtcaccttt        60
     cccaatcacc agccattcga attgcctgct gagcttttgc gcgttgcctc gccatcggcc       120
     gaggtgcagg gtcattcgcc cgaccagcgt gtgacggttc ccggcaagcg caatgtggcc       180
     attctgaaga tcgagccggt cggcaactat gcggtgcgca tcaccttcga tgatttccac       240
     gacaccggca ttttcacctg gaactacctg catacgctcg gccatgagaa ggatgagcgc       300
     tggaatgcct atctggcgga gcttgcggaa aagggcttga gccgcgatcg ctaa             354
//

If you have problems or comments...

PBIL Back to PBIL home page