(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0560

BA000012.MLL0560     Location/Qualifiers
FT   CDS_pept        complement(411026..411577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0560"
FT                   /product="succinoglycan biotynthesis protein; ExoI"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48123"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48123"
FT                   /db_xref="InterPro:IPR016071"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MJ0"
FT                   /protein_id="BAB48123.1"
FT                   /translation="MLDYGLTIIILGLLILLAARLDRVETRQTQGAAIINDGDSITLGT
FT                   ERIRMRGIDAPEYTQTCRRNGVDYACGTLARQSLVRLIAGRPVTCSGWQRDRYGRLLGD
FT                   CKAGGTDLNRAQVEAGWAVAFGDFESEEATARAAKVGIWAGTFDQPQDWRDSHHGEVVE
FT                   RKHGTLASIGDAVREIFRFW"
     gtgctggact atgggctgac catcatcatt ctggggctgc tgatcctgtt ggcggcgcgc        60
     ctggatcggg tggagacgcg tcagacgcaa ggcgcggcca tcatcaatga cggcgattcg       120
     atcacgctcg gcaccgagcg catccgcatg cgcggcatcg acgctccgga atacactcag       180
     acctgccgca ggaacggcgt cgactatgcc tgcggcacgc ttgcgcgcca gtcgctggtg       240
     cgcctgatcg ccggcaggcc cgtcacctgc agcggctggc agcgggatcg ctacggccgg       300
     ttgcttggcg actgcaaggc cggcggcacc gacctcaacc gcgctcaggt cgaagcggga       360
     tgggcggttg cctttggcga cttcgaaagc gaggaagcaa ccgcccgcgc cgcaaaggtc       420
     ggtatctggg cgggtacgtt cgatcagccg caggactggc gcgacagcca tcacggcgag       480
     gtcgtggagc gaaaacacgg cacgctggcg tcgatcggcg acgccgtgcg ggagattttt       540
     cgcttctggt ga                                                           552
//

If you have problems or comments...

PBIL Back to PBIL home page