(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0573

BA000012.MLL0573     Location/Qualifiers
FT   CDS_pept        complement(420786..421511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0573"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48134"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48134"
FT                   /db_xref="InterPro:IPR012924"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MH9"
FT                   /protein_id="BAB48134.1"
FT                   /translation="MRPRLVFTGPTLSHAEAQQVADVICLAPAVQGSIVAAVQRYDPAA
FT                   IVIIDGAFQAEPAVRHKEILWAISQGIPVIGAGSMGALRAAELYPYMHGVGLIYRWYRR
FT                   FAVLPDDAVAVLYGPKAVNFSPLTHALVDLRMTVRVAWRRNLISTDLSGKLESAARNLN
FT                   FRERTLSRMVREALPEAGDHDLQTCRQILAGAFVQQKKRDALSALQFMHENALVPAELK
FT                   NFRMTVGFVQDLEDAGLAI"
     atgcgacctc ggctcgtttt caccggccct acgctatcgc atgcagaggc acagcaggtg        60
     gccgacgtga tctgtctggc gcccgcggtg caaggctcga tcgtagctgc ggtgcaacgt       120
     tatgaccccg ctgcaattgt catcatagat ggcgctttcc aggctgagcc ggcagtgagg       180
     cacaaggaga tactgtgggc gatcagccag ggcatcccgg tgataggtgc tggaagcatg       240
     ggagccttgc gagccgcgga gctttaccca tacatgcacg gcgttggcct tatctaccga       300
     tggtaccgcc gctttgctgt cctgcctgat gacgcagtgg cagtgctcta tggtccgaag       360
     gcggtgaatt tctcgccact aacgcacgct ttggttgatt tacgaatgac cgtccgcgtt       420
     gcttggaggc ggaacctgat ctccaccgat ttgtccggaa agctcgagag tgcggcccgg       480
     aacctcaatt ttcgggaacg cacgctgtcg cgaatggtcc gcgaggcatt gccggaagcc       540
     ggtgaccatg acttgcaaac ctgccggcaa attctcgcag gagctttcgt tcagcaaaag       600
     aagcgcgacg cactgtcagc tctgcaattt atgcacgaaa atgcattggt gccggcggaa       660
     ttgaaaaatt tcagaatgac ggtcgggttc gtccaagatt tggaggacgc cgggttagca       720
     atctga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page