(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0592

BA000012.MLL0592     Location/Qualifiers
FT   CDS_pept        complement(457837..459882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0592"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48150"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48150"
FT                   /db_xref="GOA:Q98MG3"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR017037"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MG3"
FT                   /protein_id="BAB48150.1"
FT                   /translation="MEALQYLGPTGWMAIEVAVLVIVLAILLWWSGVVRYIPNDRLGIL
FT                   EKLWSFRGSVSNGFIALNREAGYQPEVVRGGLHFFMPFQYSMHRANLVTIPQGQIGYVF
FT                   ARDGKPLPPTQTLASNTDADDFQDVRGFLEKGGQKGPQRKILREGTYAINLAQFIVLTA
FT                   QSIYAVNLSSSEQNLFTNMSTMISERGGFEPVVIHNAEDMIGIVTVHDGPALPDGEIIA
FT                   PTVANDPNDPNFHNNFQDPEKFLNARGYRGRQLQVLADGSYFLNRIFATVELVKKTIID
FT                   VGTVGVVVSYNGRHGTDISGQAYRHGELVEIGSRGVWSTPLLPGKYAFNTYAGNIITVP
FT                   TTNFVLKWTKEQFGEHRLDENLSEVSLITKDAFEPVLPLSVVVHIDYMKAPLVVQRFGD
FT                   IKRLVEQTLDPMVSAYFKNIAQTKTLIQLLQERSDIQRKSGEEMREKFNSYSLELQEVL
FT                   IGTPRAANGQNSIEQILIQLRERQIAVEKVETYKLQERAAIQERTLREKEALAEQQAKI
FT                   TTSALTIEISENEGKAQLARTRQQAETIQVTAKAEAEKVRLGGQGEADMIKAIALADAE
FT                   RIKATGFADAEKVRAIGLAEAEATEKKVAAFGGPDYQLNSQVLMRFAEAIENGRLPLVP
FT                   QIQIGATGGEKGAANGLVEMMLSMLVADRVGRQTVPDEIPAPVEED"
     atggaagccc tacaatatct cggcccgacg ggatggatgg cgatcgaggt agccgtgcta        60
     gtcatcgtgc tggcaatcct gttgtggtgg agcggggtgg tccgctatat cccaaacgac       120
     aggctcggca tcttagaaaa actatggagt tttcgcggct ccgtcagcaa cggcttcatt       180
     gcgcttaacc gtgaggcagg ctaccagccg gaagtcgtgc gcggtggcct gcatttcttc       240
     atgccgttcc aatattcgat gcatcgcgcc aatcttgtca ccatcccgca gggtcagatc       300
     ggctatgtct ttgcccgtga tggcaagccg ctacctccga cacagacact tgcttccaac       360
     accgacgccg atgatttcca ggatgtgcgc ggctttctcg aaaaaggcgg acagaaagga       420
     ccgcaacgca agatcttgcg tgaaggcacc tatgctatca atctcgcaca gttcatcgtg       480
     ctgaccgcgc agtcgatcta tgccgttaat ctgagctcgt cggaacaaaa cctttttacc       540
     aatatgtcca ccatgatctc ggagcggggc ggctttgagc cagtcgtcat ccataatgcc       600
     gaggacatga tcggcatcgt caccgtccat gacggtccgg ccctaccgga cggcgagatc       660
     atcgcaccga ccgtcgccaa cgatccgaac gacccgaact tccacaacaa ttttcaggac       720
     ccggagaagt ttctcaatgc cagaggctac cgcggccggc agctgcaggt gctggccgac       780
     ggtagctact tcctcaatcg catttttgcg accgtcgaac tggtcaagaa gacgatcatt       840
     gacgttggca cggtgggtgt cgtcgtctcc tataacggcc gccacggcac ggatatatcc       900
     ggacaggcat atcgtcacgg cgagctggtc gaaatcggct cacgcggtgt ctggtccacg       960
     ccgctactgc caggcaaata tgcgttcaat acctatgccg gcaatatcat caccgtgccg      1020
     accaccaact tcgtgctcaa atggacgaag gagcagtttg gcgaacacag gctggacgag      1080
     aacctgtctg aagtgtcgtt gatcaccaag gatgcgttcg agcctgtgct gccgctctcc      1140
     gtcgtcgtgc atatcgacta tatgaaggcg ccgctcgtgg tgcagcgttt cggtgacatc      1200
     aagcggctgg tcgaacaaac gctcgatccg atggtttctg cttacttcaa gaatatcgcc      1260
     cagacaaaga cgctgatcca gcttttgcag gagcgtagcg atatccagcg caaatcgggc      1320
     gaggagatgc gcgaaaaatt caattcctac agcctcgagc tgcaggaagt gttgattggt      1380
     acgccccgtg ccgccaatgg ccagaacagc atagaacaga tcctgatcca gcttcgcgag      1440
     cgtcagatcg cagtcgaaaa ggtcgagact tataaattgc aggagagggc ggccattcag      1500
     gagcgcacgt tgcgtgagaa ggaggcgctt gccgaacagc aagccaagat cacgacatcg      1560
     gcccttacca tcgagatcag cgagaacgaa ggcaaggcgc aactcgcccg cacccgccag      1620
     caggcagaaa ccattcaggt cactgccaag gcagaggccg agaaggtgcg cctcggcggc      1680
     cagggcgagg ccgacatgat caaggctatc gcgcttgccg atgccgaacg catcaaggcg      1740
     accggttttg ccgatgccga gaaggtgcgc gccatcggtc tggcagaggc cgaggccacc      1800
     gagaagaagg tcgcggcatt cggcggcccg gactatcagc tcaactcgca ggttctcatg      1860
     cgcttcgccg aggcgatcga gaatggcagg ctaccgctcg tgccgcagat ccagatcggc      1920
     gctaccggtg gcgagaaggg ggccgccaat ggtcttgtcg agatgatgct ttcgatgctc      1980
     gttgccgacc gggttggacg gcaaaccgta ccggatgaga tcccggcacc cgttgaggag      2040
     gattga                                                                 2046
//

If you have problems or comments...

PBIL Back to PBIL home page