(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0633

BA000012.MLL0633     Location/Qualifiers
FT   CDS_pept        complement(500287..501126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0633"
FT                   /product="acyl-(acyl-carrier-protein)-UDP-N-acetylglucosamine
FT                   O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48187"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48187"
FT                   /db_xref="GOA:Q98MC6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR010137"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR029098"
FT                   /db_xref="InterPro:IPR037157"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MC6"
FT                   /protein_id="BAB48187.1"
FT                   /translation="MLMKIKTSIHPSSVVEEGAQIGEGVRIGPFCHISADAVIGDGVEL
FT                   VSHVSVMGATTIGASTKVYPMATLGAPPQNTKHKGGRTTLVIGANCTIREGVTMHVGTD
FT                   TSRGETTVGDNGNFLAYAHIAHDCVVGKNATFANGATLGGHCEIGDNVYIGGLSAVHQF
FT                   VRVGDNAFLGGCSAFVGDVIPYAIAVGNRASLRGLNIIGLKRAGLPRSEIYLLRKAYRT
FT                   IFDRSRTVGENIEFAKAEFASSPTAMKIIDFISSRGKRHYAVPSLKGGDGDDTDDED"
     gtgcttatga aaatcaagac ttcaatccat ccttcctccg tcgtggaaga aggcgcccaa        60
     atcggtgagg gtgtacgcat tgggccgttc tgccatatca gcgccgatgc cgtgatcggc       120
     gatggcgtcg aactggtcag ccatgtctcg gtcatgggtg cgacaaccat cggcgcctcg       180
     accaaggtct atccgatggc gacattgggt gcgccgccgc agaacaccaa acacaagggc       240
     ggccgcacga cgctggtcat tggcgcgaat tgcaccatcc gcgaaggcgt caccatgcat       300
     gtcggcaccg acaccagccg cggcgaaacg acggtgggcg acaatggcaa tttccttgcc       360
     tacgcccaca tcgcccatga ttgcgtggtc ggcaagaacg ccaccttcgc caatggcgcg       420
     acgctgggcg gccactgcga gatcggcgac aacgtctaca taggcggcct cagtgccgtt       480
     catcaattcg tgcgcgtcgg cgacaacgcc tttcttggcg ggtgctcggc tttcgttggt       540
     gacgtcattc cctatgccat tgccgtcggc aaccgcgcca gcttgcgcgg tttgaacatc       600
     atcggcctca agcgcgccgg tctgccgcgt tccgaaatct atctgttgcg caaagcctat       660
     aggacgatct tcgaccgctc ccgcaccgtt ggcgagaaca tcgaattcgc caaggccgag       720
     tttgcctctt cgccgaccgc catgaagatc atcgacttca tcagcagtcg cggcaagcgg       780
     cactatgcgg tgccgtcgct caagggtggc gatggcgacg ataccgacga tgaagactga       840
//

If you have problems or comments...

PBIL Back to PBIL home page