(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0636

BA000012.MLL0636     Location/Qualifiers
FT   CDS_pept        complement(502725..505109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0636"
FT                   /product="outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48190"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48190"
FT                   /db_xref="GOA:Q98MC3"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR023707"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MC3"
FT                   /protein_id="BAB48190.1"
FT                   /translation="MKAASKFLSAASAAALSAALVVPGALAVQFVATSAAEAAVVSRVE
FT                   VSGNQRVDADTIRNYITIKPGKAFSSSDVDAAVKALFGTGLFSDVQINQVGSTLVVKVA
FT                   EYKVVNQVLFQGNKKLKDNALAAAVQLKPRGTFSQATLDSDVEAVKAAYRRIGRDDAGV
FT                   TTQVMELGDNRVNVVFHITEGDRTQIAAINFVGNSAYSSRRLSDVINTKRSSWVSFILR
FT                   DDVYDEDKLRADQELLRRFYYNHGYADFQVVSAVGELDNATNKYTVTITVQEGERYNFG
FT                   DISVESTIPEVDSKSLESVVETHKGDVYNAKDVEDSIIALTEKVAGSGYAFAQVTPRGD
FT                   RNFENHTISVVYTVDQGTKAYIERIEIRGNDRTRDYVIRREFDVSEGDAFNQVLIQRAK
FT                   KRLEDLNYFDKVEISTVPGSQPDQVVLVVDVVEKSTGEFSVGAGYSTGGDSAGPSVEGS
FT                   ITERNFLGRGQFIKLSAGGGKNSRDYSVSFTEPYFLGRRIAAGFDIYKSTREYNNNYDS
FT                   DTVGATVRFGLPITNSITTQLAYNISQEKYKVDNSCGPTDPPNPPGGTCNISQAILDGI
FT                   AESPWIKSSVSLGLVYNTIDDMKNPHEGIYANTTVEVAGVGGDAKFVKITGRGSIYQTL
FT                   SEQLDLVGLISGGAGHVEGYGNDGDLRIFDHFQSTDRMIRGFAYGGIGPVASGTSGDHL
FT                   GGTTYFNASAEAQFPLPVIPESFGLRGAVFADAATLYGNKIADQTLVDQDSTGMKLRAS
FT                   VGVGLMWASPFGPIRIDYAIPVRKEASDDVQEFNFGISTRF"
     atgaaggcag catccaagtt tctgagcgcc gcgtcagcgg cggcactgtc cgccgctctg        60
     gtcgtgccag gtgcgctcgc agtacaattc gttgccacat cggcggctga agccgctgtc       120
     gtcagcaggg tggaggtgag cggcaaccag cgtgtcgacg ccgataccat ccgcaattac       180
     atcaccatca agccgggcaa agccttctcc agttccgatg tcgacgcggc cgtcaaggcg       240
     ttgttcggca ccggcctgtt ctccgacgtc cagatcaatc aggtcggctc gacgctggtg       300
     gtcaaggtcg ccgaatacaa ggtcgtcaac caggtgctgt tccagggcaa caagaagctc       360
     aaggacaatg cgctcgcggc ggcggttcag ttgaagccgc gtggcacgtt ttcgcaggcg       420
     acgctcgatt ccgatgtcga ggcggtcaag gctgcctaca ggcgcatcgg ccgcgatgat       480
     gccggcgtga ccacgcaggt catggagctc ggcgacaacc gcgtgaacgt ggtgttccac       540
     atcaccgaag gcgaccgtac gcagatcgca gcgatcaatt ttgtcggcaa cagcgcctat       600
     tcgagccgcc gtctgtcgga tgtgatcaac accaagcgtt cgtcctgggt gtcgttcatc       660
     ctgcgcgatg acgtctatga cgaggacaag ctgcgggccg accaagagct gctgcgccgc       720
     ttctactaca atcacggcta tgccgatttc caggtcgtgt cggccgttgg cgagctcgac       780
     aacgcgacga acaaatacac ggtcaccatc actgtccagg aaggcgagcg ctataatttc       840
     ggcgatatca gcgtcgaaag cacgatcccg gaagtcgact ccaagtcgct ggaatcggtg       900
     gttgagaccc acaagggcga cgtctacaac gccaaggatg tcgaggactc catcatcgcg       960
     ctcaccgaga aggtggctgg ttcaggctat gccttcgcgc aggtgacgcc gcgcggcgat      1020
     cgcaatttcg agaaccatac gatttcggtg gtctatacgg tcgaccaggg caccaaggcc      1080
     tatatcgagc gcatcgagat ccgcggcaat gaccgcacgc gtgactatgt catccgccgc      1140
     gagttcgacg tcagcgaagg cgatgcgttc aaccaggtgc tcatccagcg cgcgaagaag      1200
     cgtctggaag acctgaatta ttttgacaaa gttgaaatct cgacagtgcc cggctcgcag      1260
     cccgatcagg tcgtgctggt ggtcgacgtg gtcgagaagt cgaccggtga attctccgtt      1320
     ggcgccggct attcgaccgg cggtgactcg gcaggcccat ccgtcgaagg ctcgatcacc      1380
     gagcgcaact tcctcggtcg cggccagttc atcaagctgt cggcgggcgg cggcaagaat      1440
     tcacgcgact actccgtatc gttcaccgag ccgtatttcc tcggacggcg catcgccgcc      1500
     ggcttcgaca tctacaagtc gacgcgggaa tacaacaaca actatgacag cgacaccgtc      1560
     ggtgcgacgg tgcgcttcgg cctgccgatc accaacagca tcacgaccca gttggcgtat      1620
     aatatctctc aggagaagta taaggtcgac aacagttgcg gccctaccga ccctccgaat      1680
     cctcccggcg gcacctgcaa catttcgcag gccatcttgg atggcatcgc ggaaagcccc      1740
     tggatcaagt cttcggtcag cctgggattg gtctacaaca ccatcgacga catgaagaac      1800
     ccgcatgagg gtatctatgc caacacgacc gtcgaggtcg cgggcgtcgg cggcgatgcc      1860
     aagttcgtga agatcaccgg acgcggcagc atctaccaga cgctgtccga gcagcttgac      1920
     cttgtcgggc tcatttcggg cggcgcaggc catgtcgagg gttacggcaa cgacggcgac      1980
     ctgcgcatct tcgatcactt ccagagcacc gatcgcatga tccgcgggtt tgcctatggt      2040
     ggcatcggcc cggttgcttc cggcaccagt ggcgaccatc tgggcggcac aacatatttc      2100
     aacgcttcgg ccgaagccca gttcccgctg ccggtcattc ccgagagctt cggtctgcgt      2160
     ggcgcggtgt tcgccgacgc ggcgacgctt tacggcaaca agattgctga tcagaccctg      2220
     gtcgatcagg actcgaccgg catgaagctg cgcgcttcgg tcggtgtcgg cctaatgtgg      2280
     gcatcgccgt tcggtccgat ccgtatcgac tatgcgatcc cggtcaggaa ggaagcgagc      2340
     gacgacgtgc aggaattcaa cttcggcata tcgacccgct tctga                      2385
//

If you have problems or comments...

PBIL Back to PBIL home page