(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0646

BA000012.MLL0646     Location/Qualifiers
FT   CDS_pept        complement(510838..511434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0646"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48198"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48198"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MB5"
FT                   /protein_id="BAB48198.1"
FT                   /translation="MVHIVPNSDWLMAPRRRDMNALKHVTFAAGMALAPIDAGGAEPAG
FT                   WQALADERAVIRIADAIDRAVDAQDWTLARSYFADRVTADFSSLSGQPAANIASDDLIG
FT                   AWAGNLKGSKTSLHLRTNHQVVLEADTATVRSNGYAWNRMEGNGDPLWEVWGTYEHHLT
FT                   RSAAGWKVDGFAFHMTHERGNPWVKATPGNDTAGQ"
     gtggtccaca ttgtccccaa cagcgattgg ctgatggcac caaggagaag agacatgaat        60
     gcgttgaagc acgtaacgtt cgcggcaggc atggcactgg cgccgatcga tgccggcggg       120
     gccgaaccag ctggctggca ggcgctcgcg gacgaacgcg ccgtcatccg gattgccgat       180
     gccatcgacc gtgccgtcga cgcgcaggac tggacactgg cgcgcagcta tttcgcggat       240
     cgggtcaccg ccgatttcag cagcttgtcc gggcagccgg cggccaacat cgcctcggac       300
     gacctgatcg gcgcctgggc cggcaatctc aagggcagca agacaagcct gcacctgcgc       360
     accaatcacc aggtcgtgct tgaggcggat acggcgacgg tccgctcgaa cggctatgcc       420
     tggaaccgga tggaaggcaa tggcgacccg ctttgggaag tctggggcac ctatgagcat       480
     cacctgacgc gctccgccgc cggctggaag gtcgacggct tcgcgttcca tatgacgcat       540
     gagcgcggca acccctgggt caaggcaacg cccggcaatg acacggcggg ccagtga          597
//

If you have problems or comments...

PBIL Back to PBIL home page