(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0651

BA000012.MLL0651     Location/Qualifiers
FT   CDS_pept        complement(513472..514254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0651"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48201"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48201"
FT                   /db_xref="GOA:Q98MB2"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98MB2"
FT                   /protein_id="BAB48201.1"
FT                   /translation="MALPDFSMRQLLEAGIHFGHQTHRWNPKMAPYIYGARNNIHIIDL
FT                   SQTVPLLHQALKQVSDTVAKGGRVLFVGTKRQASDIVADAAQRSAQYYVNSRWLGGMLT
FT                   NWKTISNSIQRLRKLDEMLAGEAQGLTKKERLNLDREREKLDKALGGIKDMGSTPDLMF
FT                   VIDTNKEAIAILEAKRLGIPVVAIIDSNCDPDKIDFPIPGNDDAARAIQLYCDLIAKAA
FT                   IDGIARQQGALGVDIGASVEAPVEPALDPAPSTEAPQA"
     atggctctgc ctgatttcag catgcgccag cttttggaag ctggcattca cttcggccac        60
     cagacccacc gctggaaccc gaagatggcg ccctacatct atggcgcccg caacaacatc       120
     cacatcatcg acctctcgca gacggtgccc ttgctgcacc aggcgctgaa gcaggtttcc       180
     gacaccgtcg ccaagggcgg gcgcgtgctg ttcgtcggca ccaagcgcca ggcgtccgac       240
     atcgtcgccg atgcggcgca gcgttcggcc cagtactacg tcaattcgcg ttggctcggc       300
     ggcatgctga ccaattggaa gacgatctcg aattcgatcc agcgcctgcg caagctcgac       360
     gagatgctgg ccggcgaggc ccagggcctg accaagaagg agcgcctgaa tctcgaccgc       420
     gagcgcgaga agctcgacaa ggcgctcggc ggcatcaagg acatgggctc gacgcctgac       480
     ctgatgttcg tgatcgacac caacaaggaa gcgatcgcca tcctggaggc caagcgcctc       540
     ggcattccgg tggtcgccat catcgattcg aactgcgatc cggacaagat cgacttcccg       600
     atccccggca atgacgacgc ggcccgcgcc atccaactct attgcgacct gatcgccaag       660
     gctgcgatcg acggcatcgc ccgtcagcag ggcgcgctcg gcgtcgatat cggcgcttcg       720
     gtcgaagccc cggtcgagcc ggcgctcgat ccggctccgt cgaccgaggc cccgcaggcg       780
     taa                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page