(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0667

BA000012.MLL0667     Location/Qualifiers
FT   CDS_pept        complement(524708..525409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0667"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48213"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48213"
FT                   /db_xref="GOA:Q98MA0"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:Q98MA0"
FT                   /protein_id="BAB48213.1"
FT                   /translation="MLGAIIGLVALLLVLLGVASAFLRADPARLATGMRTLGPILLALV
FT                   GAAVLLVGRSGIGGVMLFVAIGWYAATRANRPDVKPVPGKRSTVRTAALEMELDHDTGG
FT                   LEGLVLAGRHDGKMLGAMGLAELQHLYRELSGDAESRQLLETYLDGRFPVWRKNTETNG
FT                   GEGLGVAPGPGAMTKEEAYKVLGLEAGAAAADVRKAHRRLMQRLHPDVGGTSFLAARIN
FT                   EAKDVLLSNHN"
     atgttaggcg caattatcgg tctggtcgca ttgctgctgg tgctcctggg tgttgcctcg        60
     gccttcctcc gggccgatcc cgcccggctg gcaaccggca tgagaacact gggaccgatc       120
     ctgctggcac tggtgggcgc cgccgtgctt ctggtcggtc gaagcggaat cggcggcgtc       180
     atgctgttcg tggcgatcgg ctggtatgcc gccacgcgcg cgaaccggcc cgatgtgaag       240
     ccggtgccgg gaaaacgctc aacggtgcgg acggcagcac tcgaaatgga gctggatcac       300
     gataccggcg gccttgaagg actggttctg gccggccgcc atgacggcaa gatgcttggc       360
     gcgatgggcc ttgcggagct gcagcatctt taccgcgaac tctccggcga cgcggagagc       420
     cgccagctgc tagagacgta tcttgacggc agatttcccg tctggcgcaa aaacactgag       480
     acgaacggtg gcgaagggct gggtgttgcg ccaggtccgg gcgccatgac taaggaggag       540
     gcctacaagg tccttggtct tgaagcgggg gccgccgcgg cggatgtccg caaggcgcac       600
     cgccgcctga tgcagcgcct gcaccccgat gtcggcggca cgtctttcct ggcggcgcga       660
     atcaacgaag ccaaggacgt cttgctctcc aatcacaact ag                          702
//

If you have problems or comments...

PBIL Back to PBIL home page