(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0674

BA000012.MLL0674     Location/Qualifiers
FT   CDS_pept        complement(528462..529259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0674"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48217"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48217"
FT                   /db_xref="GOA:Q98M96"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M96"
FT                   /protein_id="BAB48217.1"
FT                   /translation="MFFLLSKVFWFFVQPLNLTIFLLLAGLIAGMIGRRRLAVTGSVLA
FT                   FLILALSTWTSLGAMMLNPLEERFPRPPLPQKVDGIVVLGGGFEGAINLARGGYELSSS
FT                   GDRMVETAILARRFPLAKVVVSGGHGAFFIDAEGDADSASRMLVPLGVSADRLVLEDKS
FT                   RNTYENAIFSRKLVEPKPGETWLLVTSAFHMPRAKALFDKAGFPTVPWPVDYHTSGKEG
FT                   VGLFRDNAIDSVQNTTIALREWIGLFAYWLSGRIDQPFPGPGG"
     atgttcttcc ttctttccaa ggtcttctgg ttcttcgtcc agccgctcaa cctgacgatc        60
     ttcctgcttc tggcggggct gatcgccggg atgatcggcc ggcggcggct ggccgtcacc       120
     ggcagtgtgc tagccttctt gattttggcg ctctcgacct ggacgtcgct tggcgcgatg       180
     atgctcaacc cgctcgagga gcgatttcca cggccgccgc tgccgcaaaa ggtcgacggc       240
     atcgtcgtgc tgggcggcgg cttcgagggc gccatcaacc tcgcacgtgg cggctatgaa       300
     ttgagcagca gcggcgaccg catggtcgag accgcaatcc tcgcccggcg cttcccactg       360
     gccaaagtgg ttgtatcagg cggacacggc gcgtttttca tcgacgccga gggggacgcc       420
     gactcagcgt cccgcatgct cgttccgctc ggtgtatcgg ccgatcgtct tgtcctggaa       480
     gacaagtccc gcaacacgta cgaaaatgcg atcttcagcc gcaaacttgt cgagccgaag       540
     ccgggcgaga cctggctgct ggtgacctcc gccttccaca tgccacgggc caaggcgctg       600
     ttcgacaagg ctggttttcc aaccgtccca tggccggtcg actatcacac ctccggcaag       660
     gaaggtgtcg gcttgtttcg cgacaatgcg atcgattccg tgcagaacac caccatagcg       720
     ctccgcgaat ggatcgggct ttttgcctat tggctttccg gccgcatcga tcagcctttt       780
     ccggggccgg gcggctga                                                     798
//

If you have problems or comments...

PBIL Back to PBIL home page