(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0675

BA000012.MLL0675     Location/Qualifiers
FT   CDS_pept        complement(529288..530853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0675"
FT                   /product="Glu-tRNA(Gln) amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48218"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48218"
FT                   /db_xref="GOA:Q98M95"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98M95"
FT                   /protein_id="BAB48218.1"
FT                   /translation="MSDLTRLTISQARAKLRGKEITATEITEAYLSAIDRANPALNAYV
FT                   AVTGDRARDMAKASDARLVKGEGGALEGIPLGIKDLFGTEGVHTQACSHVLDGFKPLYE
FT                   STVTANLWADGAVMLGKLNMDEFAMGSSNETSYYGPVINPWRRSRLDTVVMPTTHQGDG
FT                   GFVSAGGTKTQRSLDNAQLVPGGSSGGSATAVSAFLCAGATATDTGGSIRQPAAFTGTV
FT                   GIKPTYGRCSRWGIVAFASSLDQAGPIARDVRDAAILLKSMASVDPKDTTSVDRPVPDY
FT                   EAAIGKPIKGMKVGIPKEYRVDGMPEEIEALWQKGIAWLRDAGAEIVDISLPHTKYALP
FT                   AYYIVAPAEASSNLARYDGVRYGLRVPGKDIVEMYEKTRAAGFGREVKRRIMIGTYVLS
FT                   AGYYDAYYLQAQKVRNLIKRDFENVFAAGVDVILTPATPSAAFGIADEDMAADPVKMYL
FT                   NDIFTVTVNMAGLPGIAVPAGLDPKGLPLGLQLIGRPFEEETLFQTAAVIEQAAGTFQP
FT                   EKWW"
     atgagcgacc tgaccagact gacgatttca caggctcgcg ccaagctgcg cggcaaggaa        60
     atcaccgcga cagagatcac cgaggcctat ctctcggcga tcgatcgcgc caatccggcg       120
     ctcaatgcct atgtcgcggt gactggcgac agagcgcgtg acatggccaa ggcgtccgac       180
     gccaggctgg tcaagggcga gggcggggcg ctggagggca ttccgctggg catcaaggac       240
     ctgttcggca ccgaaggtgt ccacacccag gcctgcagcc acgtgctcga cggcttcaag       300
     ccgctctacg aatcgactgt caccgccaat ctgtgggcgg atggcgcggt catgctcggc       360
     aagctcaaca tggacgagtt cgccatgggc tcgtccaacg agacctccta ttacggcccg       420
     gtcatcaacc cgtggcggcg ttcgcgcctc gacacggtgg tgatgccgac gacgcatcag       480
     ggcgacggcg gttttgtctc ggccggcggc acgaaaaccc agcgcagcct ggacaacgcg       540
     cagctggttc cgggtggctc ttccggcggc tcggcgacgg ccgtctcggc gttcctgtgc       600
     gccggcgcca cggcgaccga tacgggcggc tcgatccgcc agccggcggc cttcaccggc       660
     accgtcggca tcaagccgac ctatggccgc tgctcgcgct ggggcatcgt cgccttcgcc       720
     tcgtcgctcg accaggccgg accgatcgcg cgcgatgttc gcgacgccgc gatcctgctc       780
     aaatccatgg cctcggtcga tccgaaggac accacttccg tcgaccggcc ggtgccggac       840
     tatgaggcgg cgatcggcaa gccgatcaag ggcatgaagg tcggcattcc caaggaatac       900
     cgcgttgacg gcatgcccga ggagatcgag gcgctgtggc agaagggcat tgcctggctc       960
     agggatgccg gcgccgagat cgtcgacatt tcgctgccgc atacgaaata cgcgctgccg      1020
     gcctattaca tcgtggcgcc cgccgaggct tcgtccaacc tggcgcgcta tgacggcgtc      1080
     cgctacggct tgcgcgtgcc gggcaaggac attgtcgaga tgtatgagaa gacccgcgcc      1140
     gccggtttcg gccgcgaggt caagcgccgc atcatgatcg gcacctatgt gctgtcggcc      1200
     ggctattacg acgcctatta tctgcaggca cagaaggtgc gcaatttgat caagcgcgac      1260
     ttcgaaaatg tcttcgccgc cggcgtcgac gtcatcctga ccccggcgac gccgtccgcc      1320
     gccttcggca tcgccgatga ggacatggcc gccgacccgg tgaaaatgta cctcaacgac      1380
     attttcacgg tcaccgtgaa catggcgggc ctgcccggca tcgccgtgcc cgccggcctc      1440
     gatcccaagg ggctgccgct cggcctgcag ctgatcggcc ggccgttcga ggaagagacg      1500
     ctgttccaga ccgccgccgt catcgagcag gcggccggca catttcagcc tgagaagtgg      1560
     tggtaa                                                                 1566
//

If you have problems or comments...

PBIL Back to PBIL home page