(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0692

BA000012.MLL0692     Location/Qualifiers
FT   CDS_pept        complement(543270..545252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0692"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48233"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48233"
FT                   /db_xref="GOA:Q98M80"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR032790"
FT                   /db_xref="InterPro:IPR032856"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M80"
FT                   /protein_id="BAB48233.1"
FT                   /translation="MLSEFRLTVGGRSTSLLGASLSQDNVLFTTNLTNLPIESAAGRQI
FT                   PQGAMHIERVRLLWEERLYERITLSNYSREHSTILLSLRFAADFRDMFEVRGSTRLKRG
FT                   TADTAEIAGNAVVLRYEGLDKVVRTSAISFSQTPDQLTSERADFVIAVTKRSSQTLYVE
FT                   VGNATDDRPESRRFRAAAARARFGMRAKRRHGATLHSSGRVFNDWMERARADVALLTTE
FT                   LATGPYPYAGIPWFSTAFGRDGVISALQMLWLNPGLARGVLAFLAQHQATETSPFSDSE
FT                   PGKIMHETRKGEMVALSELPFGRYYGGVDTTPLYIHLACAYADRTGDTAFIDTLWPSLC
FT                   AAAEWIETASRSTGFLTYQRAAESGLANQGWKDSFDSVFHADGRIPKGPIALVEVQGYV
FT                   FAAFQGLAKLARLRGEAERAESWEIRADAIRQKVERHFWMEDLGYYALALDGDGLPCKV
FT                   RTSNAGHLLYVGLPGPDRARMVADQLLSASFHSGWGLRTLADDAIFFNPMSYHNGSIWP
FT                   HDTAICAAGLARYGSRDSVVRLMSGTFESAVHFNMRLPELFCGFTRAAGEAPIAYPVAC
FT                   LPQAWSAGSAFMLMQSCLGLQIDGWTGEIHVTRPRLPIGIDNLVIRHLSVGQAAVDLTF
FT                   QRVGDRVGAFLAEPHEGLVPLVVRS"
     gtgctctccg aatttcgcct caccgtcggc gggcggtcga cgtcgttgct gggcgcgtcg        60
     ctcagccagg acaacgtgct cttcaccacc aacctcacca atctgccgat cgagagcgcc       120
     gctggccgcc agattccgca aggcgctatg catatcgagc gcgtgcggct gttgtgggag       180
     gaaaggctgt atgagcgcat aacgctgtcc aactacagcc gcgagcattc gacgatcctg       240
     ctgtcgctgc gttttgccgc cgatttccgc gacatgttcg aggtccgcgg ctcgacccgc       300
     ttgaagcgtg gaaccgccga tacggccgag atcgcaggga acgcggtcgt gcttcgctac       360
     gaaggcctgg acaaggtcgt gcggacatcg gcgatttcat tctcacagac gcccgatcaa       420
     ctgacttccg aacgcgccga tttcgtcatc gccgtcacca agcgcagcag ccagacgctt       480
     tatgtggaag tgggcaacgc gacagacgat cgccccgaaa gccgccggtt tcgcgcggct       540
     gccgcccgcg ctcgcttcgg catgcgcgcc aagcgccggc acggcgcgac gctgcacagt       600
     tccggtcgcg tcttcaacga ctggatggag cgcgcgcgcg ccgacgtcgc gctgctcacc       660
     acggaactgg cgaccgggcc ctatccctat gccggcattc cctggttctc caccgcgttt       720
     ggccgggatg gcgtgatctc ggccttgcag atgctttggc tcaatcccgg cctggcgcgg       780
     ggcgtcctag cgtttctggc ccagcaccag gcaaccgaga catcgccttt cagcgattcc       840
     gaacccggca agatcatgca cgagacccgc aagggcgaga tggtggcgct gagcgagttg       900
     ccgttcggcc gctattatgg cggcgtcgac acgacgccgc tctatatcca tcttgcctgc       960
     gcctatgctg accgcacggg cgatacggcc ttcatcgata cgctgtggcc atcactgtgc      1020
     gccgcggccg agtggatcga gacggcgagc cgttcgacgg gattcctcac ataccagcgc      1080
     gccgcggaat ccggccttgc caaccaggga tggaaggaca gtttcgattc tgtcttccac      1140
     gccgatggcc gcatcccgaa ggggccgatc gcgctggtcg aggtgcaggg ctacgtcttc      1200
     gcggcgttcc aggggttggc gaagctggca cggctgcgtg gcgaggcgga acgcgccgag      1260
     agctgggaaa tacgcgccga tgccattcgc caaaaagtcg agcgccattt ctggatggaa      1320
     gacctcggct actatgcgct agcgttggac ggcgatggtc taccctgcaa ggtgcgcacg      1380
     tccaacgccg gtcacttgct ttatgtcggc cttcccggtc cggatcgcgc gcgcatggtt      1440
     gccgaccagc tcctgtcagc gtcgtttcat tctggctggg ggctgcggac gctggccgac      1500
     gatgcgatct tcttcaatcc gatgtcctat cacaacggct ccatttggcc gcatgatacg      1560
     gcgatctgcg ctgccggact ggcgcgatac ggcagccgcg acagcgtcgt gcggctgatg      1620
     agcggcacct tcgaatccgc cgttcatttc aacatgcgac tgcccgaatt gttttgcggc      1680
     ttcacgcgtg cggccggtga agcgccgatc gcctatccgg tggcctgcct gccgcaagcc      1740
     tggtccgccg gctccgcctt catgctcatg caatcatgcc tcggcctgca aatcgatggc      1800
     tggacaggtg aaatccatgt gacgcggccg cgcctgccga tcggcatcga taacctcgtc      1860
     atccgccatc tttcggtagg gcaggcggcg gtggatctga cattccagcg cgtcggggat      1920
     cgcgtcggcg ccttccttgc cgaaccgcat gaggggctgg tgccgctcgt ggtcaggagc      1980
     tga                                                                    1983
//

If you have problems or comments...

PBIL Back to PBIL home page