(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0696

BA000012.MLL0696     Location/Qualifiers
FT   CDS_pept        complement(549706..551079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0696"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48237"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48237"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M76"
FT                   /protein_id="BAB48237.1"
FT                   /translation="MVGCETDRRRHLRVLITNLFVSHNSGTEVVVELLADGLRGAGHQT
FT                   MVLAPTLGDMADRMRRRGHHVVDRIAEIVEKPDIIHGQHLTPCLTALARFPDVPAVFSC
FT                   HSAFFEIEAPMLHPQIRRWIAVDEACKAKCLSRGVPADRLDLIYNAVDLHRFKPRLPLP
FT                   SRPARALLLTKNFEHQQAVREACSKSNIALDEVGPATERFSHQLEKDLPEYDIVFATAR
FT                   MALEAAAVGCSVVVCDARGFAGLLDTANMEAWRRMNLGVGLLTRPTTVENLMEAISRFD
FT                   AGDAAKVCAYFREVADVSHFVQEHLKAYNQAIQAQTNTTADERSLATARWIEEIGVSVA
FT                   PRRWAHIVKEVHGWQVSPDQTALVELLQSNTKTLESNVASLVELGEQVKAIGPEIAKPI
FT                   LDASASLDRVAQDSQARLHRIDDELSRLSNFVNEIKGLYNGMIPLFIRRMFLRVRRRG"
     gtggtgggtt gcgaaacaga ccggaggcgg catttgcggg ttctcatcac caatctgttc        60
     gtatcgcaca acagcggcac cgaagtggtt gtcgaattgc tggccgacgg gcttcgcggc       120
     gccggtcatc aaaccatggt gctggcgcca acacttggcg acatggccga cagaatgcgc       180
     agacggggac accatgtggt ggaccggatt gccgagattg tcgaaaagcc cgacatcatc       240
     catggccagc atttgacgcc ttgcctgacg gcgctggcgc ggtttcccga cgtgcctgcc       300
     gtgttttcct gtcatagcgc tttctttgag atcgaagctc ccatgcttca tccgcagata       360
     cgccgctgga tcgcggtcga cgaagcgtgc aaggccaagt gcttgtcgcg cggtgtaccg       420
     gctgacaggt tggacctcat ctacaacgca gtcgaccttc accgtttcaa gccgcgcctg       480
     ccgctacctt ccaggcccgc cagagcgctg ctgctgacca agaatttcga acaccagcag       540
     gcggtgcgtg aggcctgctc gaagagcaat atcgcgttgg atgaggtggg tccggctacc       600
     gaacgctttt cccatcagct cgaaaaggat ttgcctgaat acgacatcgt ctttgcaacc       660
     gcccgtatgg cccttgaagc ggccgcggtg ggctgttcgg tcgtcgtctg cgacgcgcgt       720
     ggcttcgccg gcctgctcga tacagcgaac atggaggcat ggcggcgcat gaacctcggg       780
     gttggtcttc tgacgaggcc gaccaccgtc gagaacctga tggaggcgat ctcgcggttc       840
     gatgccggcg atgccgcgaa ggtttgtgcc tatttccgtg aagtggctga tgtctcgcac       900
     ttcgttcaag agcatctcaa ggcctacaat caggccatac aggcgcagac gaatacgact       960
     gccgacgagc ggtcgctggc aaccgcgcgc tggatagagg aaatcggcgt ttcggttgcg      1020
     ccccgcagat gggcccatat tgtgaaagag gttcatggat ggcaggtttc gccagaccag      1080
     accgcgcttg tggaattgct gcaatcaaac acaaaaacgc tggagagcaa tgtcgcgtcg      1140
     ttggtagagc ttggcgagca ggtcaaagcc atcggacccg aaatcgcaaa accgatcctt      1200
     gatgcctccg cttcgctcga cagggtggcc caggacagcc aggccagatt gcatcgaatt      1260
     gacgacgagt tgtcgcgcct ttcgaatttc gtcaatgaga tcaaagggct ctacaacggc      1320
     atgatcccgc ttttcatcag aagaatgttt ctcagggttc gcaggcgagg gtga            1374
//

If you have problems or comments...

PBIL Back to PBIL home page