(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0702

BA000012.MLL0702     Location/Qualifiers
FT   CDS_pept        complement(554582..556306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0702"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48241"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48241"
FT                   /db_xref="GOA:Q98M72"
FT                   /db_xref="InterPro:IPR014597"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M72"
FT                   /protein_id="BAB48241.1"
FT                   /translation="MRRQFLTSTTALVLLLGVGNAYAGMDEAKAFLDKEIGGVSTLSRA
FT                   DQEKQMQWFIDAAKPFAGMDIKVVSETLTTHQYESQVLAPAFTAITGIKVTHDVIQEGD
FT                   VVEKIQTQMQTGQNIYDGWVNDSDLIGTHWRYQQVRNLTDWMAGEGKDVTDPMLDVDDF
FT                   IGTKFTTAPDKKLYQLPDQQFANLYWFRYDWFNDEKNKADFKAKYGYDLGVPVNWSAYE
FT                   DIAEFFTGRDVNGKKVYGHMDYGKKDPSLGWRFTDAWLSMAGNGDKGLPNGVPVDEWGI
FT                   KVDAKSRPVGSCTARGGDTNGPASVYAIQKYLDWLKAYAPPEAQGMTFSESGPVPSQGN
FT                   VAQQIFWYTAFTADMVKPGLPVMNDDGTPKWRMAPSPHGSYWKDGMKLGYQDVGSWTLM
FT                   KSTPTDRAKAAWLYAQFVTSKTVDVKKSQVGLTFIRDSTIHDKSFTERAPKLGGLIEFY
FT                   RSPARVQWTPTGTNVPDYPKLAQLWWQNIGDASSGAKTPQEAMDSLCADQEKVMARIEK
FT                   SGVQGDIGPKMAEEHDLAYWNADAVKGGNLAPQLKLEQEKDKPITINYDELVKSWQK"
     atgcgacggc aatttttaac atcaacaacg gcccttgtcc tattgctcgg tgtaggcaat        60
     gcctacgccg ggatggatga agcaaaagcc tttctggaca aagagattgg cggcgtgtcg       120
     acgctttcgc gcgccgacca ggaaaagcaa atgcagtggt tcatcgacgc cgccaagccc       180
     ttcgccggca tggacatcaa agtcgtgtcg gaaaccttga ccacccacca gtacgagtct       240
     caggtgctgg cgccggcctt taccgccatc accggcatca aggtcacgca tgacgtcatc       300
     caggaaggcg acgtcgtcga gaagatccag acccagatgc agaccggcca gaacatctat       360
     gacggctggg tcaacgattc cgatctgatc ggcacccatt ggcgctacca gcaggtgcgc       420
     aatttgaccg actggatggc gggcgaaggc aaggacgtta ccgatccgat gctcgacgtc       480
     gacgacttca tcggcacgaa gttcaccacc gcgccggaca agaagctcta ccagctgccc       540
     gaccagcagt tcgcgaacct ctactggttc cgttacgact ggttcaacga tgagaagaac       600
     aaggccgact tcaaggccaa gtacggctat gatctcggcg tgccggtcaa ctggtcggcc       660
     tatgaggaca tcgccgaatt cttcaccggc cgcgacgtca acggcaagaa ggtctatggc       720
     cacatggact acggcaagaa ggatccgtcg ctcggctggc ggttcacgga cgcctggctg       780
     tcgatggccg gcaatggcga caagggcctg ccgaacggtg tgccggtcga cgaatggggc       840
     atcaaggtcg atgcgaagtc gcggcctgtc ggctcgtgca ccgcgcgcgg cggcgacacc       900
     aatggaccag catcggtcta tgccatccag aagtatcttg attggctgaa agcctatgcg       960
     ccgccggaag cccagggcat gaccttctcc gaatccggcc ccgtgccgtc gcaaggcaat      1020
     gttgcccagc agatcttctg gtacaccgcg ttcaccgccg acatggtcaa gcccggcttg      1080
     ccggtcatga acgacgacgg cacgccgaag tggcgcatgg cgccgtctcc gcacggctcc      1140
     tactggaagg acggcatgaa gctcggctat caggacgtcg gttcctggac gctgatgaag      1200
     tcgacgccga ccgaccgcgc caaggccgcc tggctttatg cccagttcgt cacctcgaag      1260
     accgtcgacg tgaagaagag ccaggttggc ctcaccttca ttcgcgactc caccatccat      1320
     gacaagagct tcaccgaacg tgcgccgaag ctcggcggcc tgatcgagtt ctatcgctcg      1380
     ccggcccgtg tgcagtggac gccgaccggt accaacgtgc cggactatcc gaagctggcg      1440
     cagctctggt ggcagaacat cggtgacgca tcgtctggtg ccaagacacc gcaggaagcc      1500
     atggattcgc tctgcgccga tcaggaaaaa gtcatggcac gtatcgagaa atccggcgtc      1560
     cagggcgaca tcggaccgaa gatggccgaa gagcatgacc ttgcctactg gaacgccgac      1620
     gcggtcaaag gcggcaatct ggcgcctcag ctgaagctcg agcaggagaa ggacaagccg      1680
     atcaccatca actacgacga actggtgaag agctggcaga agtaa                      1725
//

If you have problems or comments...

PBIL Back to PBIL home page