(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0713

BA000012.MLL0713     Location/Qualifiers
FT   CDS_pept        complement(564834..565565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0713"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48250"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48250"
FT                   /db_xref="GOA:Q98M63"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016545"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M63"
FT                   /protein_id="BAB48250.1"
FT                   /translation="MTYCVGLKIDRGLVFMSDTRTNAGMDSISTFKKMHVWEQPGERVI
FT                   VLMSAGNLATTQAVVSLLDERTKAVTDRHEKLLETPSMYQTVRLVGDTVKEVIAQSSPA
FT                   GEKADSYFNASFILGGQILGSPPRLFMIYPEGNFIESTDDTPFFQIGETKYGKPIIIRA
FT                   YERTMSLAETVKLLLVSFDSTLKSNLSVGLPLDLLFLEKDAFKVGLKKRIAQDDQYYRT
FT                   ISDGWSNALKSAFASLPDFPG"
     atgacctatt gcgtcggcct gaagatcgat cgcgggctcg tgttcatgtc ggacacgcgc        60
     accaatgccg gcatggattc gatctcgacc ttcaagaaga tgcatgtctg ggaacagccg       120
     ggtgagcgcg tcatcgtctt gatgtcggcc ggcaacctgg cgacgacgca ggccgtggtc       180
     agcctgctcg acgaacgcac caaggcggtg accgaccgcc acgagaagct gctcgagacg       240
     ccatccatgt accagacggt gcggctggtg ggcgacacgg tgaaagaggt gatcgcgcaa       300
     tcgtctcccg ccggcgagaa ggccgattcc tatttcaacg cctccttcat cctcggcggc       360
     cagatcttgg gcagtccgcc gcggctgttc atgatctatc ccgagggcaa tttcatcgaa       420
     tcgaccgacg acacgccgtt cttccagatc ggcgagacca aatacggcaa gccgatcatc       480
     atccgcgcct atgagcggac gatgagcctg gccgagacgg tgaagctgct cctggtgtcg       540
     ttcgattcga cactcaagtc gaacctgtcg gtcggcctgc cactcgacct gctgttcctg       600
     gaaaaggacg ccttcaaggt tggcctgaag aagcggatcg ctcaggacga ccagtattac       660
     cgcaccatct ccgatggctg gtcgaatgcg ctgaagagcg cctttgccag cctgccggat       720
     tttccggggt ga                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page