(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0732

BA000012.MLL0732     Location/Qualifiers
FT   CDS_pept        complement(575010..577730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0732"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48264"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48264"
FT                   /db_xref="GOA:Q98M49"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:Q98M49"
FT                   /protein_id="BAB48264.1"
FT                   /translation="MQSSYLSYAMSVIVSRALPDVRDGLKPVHRRILYAAHESGYHWNR
FT                   KYVKSARPVADVMGKYHPHGDASIYDALVRMAQDWSLRVPLIDGQGNFGSIDGDPPAAM
FT                   RYTESRLTKVAHELLEDIDKDTVDFQETYDASDTEPKVLPARFPNLLVNGSGGIAVGMA
FT                   TNIPPHNLGEVCNGAIAIIDNPAIDLPALMEIIPGPDFPTGGIVLGRSGIYSAYSTGRG
FT                   SIVMRGKVNIEQRGNDRESIIITEVPYQVNKASMIEKMAELVRDKRIEGISDIRDESDR
FT                   QGYRVVIELKRDAVADVILNQLYRFTPLQTSFGANMVALNGGKPELLTLTDMLKAFVSF
FT                   REEVITRRTKFLLRKARDRAHVLVGLAIAVANIDEVIKLIRTAPDPQTAREQLMERRWP
FT                   AGDVESLILLIDDPRHRINADGTYNLSEEQARAILELRLQRLTALGRDEIADELNSIGA
FT                   EIVDYLDILSSRARVQQIVKDELAAVRDEFGTPRRTELTDGGADMEDEDLIQREDMVVT
FT                   VSHSGYIKRVPLSLYRAQRRGGKGRSGMSTKEEDFVTRLFVANTHTPVLFFSSRGIVYK
FT                   EKVWRLPIGNPQSRGKALINMLPLEQGERITTIMPLPEDETSWGELDVMFATTRGTVRR
FT                   NKLSDFVQVNRNGKIAMKLEEEGDEILGVETCTDNDDVLLTASSGQCIRFSVGDVRVFQ
FT                   SRNSVGVRGITMAETDRIISMSVIENVDASPAERAAYLKRAAAERRLAAGANGEEEEIA
FT                   LTNEEIGEEAELSDERYEFLKAHEQYVLTVTEYGYGKRSSSYDFRLTGRGGKGIRATDV
FT                   SKTAEIGRLVATFPVGNDDQIMLVSDGGTVIRVPVNGIRFASRATKGVTIFNTAEGEKV
FT                   VSVERISEPQSDEESEETVEGGTESAPDAGPENAE"
     atgcagagct cgtatctttc ttacgccatg agcgtgatcg tcagccgtgc gctgcccgat        60
     gtgcgcgacg gcctgaagcc cgtgcatcgc cgcattctct atgcagcgca tgagagcggt       120
     taccactgga accgcaaata tgtgaagtcg gcccgcccgg tcgccgacgt gatgggtaaa       180
     taccatccgc atggcgacgc ctcgatctat gacgccttgg tgcgcatggc gcaggattgg       240
     tcgctgcgcg tgccgctgat cgacgggcag ggcaatttcg gctcgatcga cggcgacccg       300
     ccggcggcca tgcgctacac cgaatcgcgg ctgaccaagg tcgcgcatga gcttttggag       360
     gacatcgaca aggacacggt cgattttcag gagacttatg atgcctcgga caccgaaccg       420
     aaggttctgc cggcgcgctt tcccaatctg ctggtcaacg gctccggcgg catcgccgtc       480
     ggcatggcca ccaacatccc gccgcacaat ctgggcgaag tctgcaacgg cgccatcgcc       540
     atcatcgaca atccggcgat tgacctgccg gcgctgatgg agatcattcc aggccccgac       600
     ttcccgaccg gcggcattgt gcttggccgt tccggtatct acagcgccta ttcgaccggt       660
     cgtggctcga tcgtcatgcg cggcaaggtc aacatcgaac agcgcggcaa tgaccgtgaa       720
     tcgattatca tcaccgaggt tccctaccag gtgaacaagg cctcgatgat cgagaagatg       780
     gccgagctgg tgcgcgacaa gcgcatcgaa ggcatttccg acatccgcga cgaaagcgac       840
     cgccaaggtt accgtgtcgt catcgagctg aagcgcgacg ccgtcgccga cgtcatcctc       900
     aaccagcttt accgcttcac gccgctgcag acctctttcg gcgccaatat ggtggcgctg       960
     aatggcggca agccggaact gctgaccctg accgacatgc tgaaggcgtt cgtctccttc      1020
     cgcgaagagg tcatcacaag gcggacgaaa ttcctgctgc gcaaggcgcg cgaccgcgcc      1080
     catgtgttgg tgggtcttgc catcgccgtc gccaatatcg acgaggtcat caagctgatc      1140
     cgcaccgcgc ccgatccgca gacggcgcgc gagcagttga tggagcggcg ctggccggcc      1200
     ggtgatgtcg aatcgctgat ccttctgatc gacgatccgc gccaccgcat caatgcggac      1260
     ggcacctaca atctgtccga ggaacaggcg cgcgccatcc tcgaactgcg cctgcagcgc      1320
     ctgaccgcgc tcggccgcga cgagatcgcc gacgagttaa actcgatcgg cgccgaaatc      1380
     gttgattatc tggacatttt gtcgtcccga gctcgtgtcc agcagatcgt caaggacgag      1440
     cttgccgccg tgcgcgacga gttcggcacg ccgcgccgca cggagctgac cgacggcggc      1500
     gccgacatgg aagacgagga cctgatccag cgcgaggaca tggtcgtgac ggtgagccat      1560
     tccggctaca tcaagcgtgt gccgctttcg ctctaccggg cgcagcgccg cggcggcaag      1620
     ggccgctccg gcatgtcgac caaggaagag gatttcgtga ccaggctgtt cgtggccaac      1680
     acgcacacgc cggtgctgtt cttctcctcg cgcgggatcg tctacaagga aaaggtctgg      1740
     cggctgccga tcggcaatcc gcagtcacgc ggcaaggcgc tgatcaacat gctgccgctc      1800
     gagcagggcg aacgcatcac caccatcatg ccgctgcccg aggacgagac cagctggggc      1860
     gagctcgacg tgatgttcgc caccacgcgc ggcaccgtgc gccgcaacaa gctgtccgat      1920
     ttcgtccagg tcaaccgcaa cggcaagatc gccatgaagc tggaggagga aggcgacgag      1980
     atcctcggcg tcgagacctg caccgacaac gacgacgtgc tcttgaccgc cagttccggc      2040
     cagtgcatcc gcttctccgt cggcgatgtg cgcgtcttcc agagccgcaa ctcggtcggc      2100
     gtgcgcggca tcaccatggc cgagaccgac cgcatcatct caatgtcggt gatcgagaat      2160
     gtggacgcgt cgccggcaga gcgtgccgct tacctcaagc gggcagcggc cgagcgccgc      2220
     cttgccgctg gcgctaacgg cgaagaggaa gagatcgcgc tgaccaatga ggagatcggc      2280
     gaggaggctg agctttcaga cgaacgctat gagttcctca aggcgcatga gcagtatgtg      2340
     ctgacggtga ccgaatatgg ctacggcaag cgttcgtcgt cctacgattt ccgcctgacc      2400
     ggccgcggcg gcaagggcat ccgcgccacc gacgtgtcga agacggccga gatcggccgg      2460
     ctggtggcga ccttcccggt cggcaatgac gatcaaatca tgctggtgtc ggatggcggc      2520
     acagtcatcc gggtgccggt caacggcatt cgtttcgcca gccgcgccac caagggcgtg      2580
     accatcttca acacggccga aggtgagaag gtggtttcgg tcgaacggat ttccgagccg      2640
     cagtcggacg aggaaagcga agagaccgtc gagggcggta cggaatcagc tcccgacgca      2700
     ggtccggaaa acgctgaata a                                                2721
//

If you have problems or comments...

PBIL Back to PBIL home page