(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0817

BA000012.MLL0817     Location/Qualifiers
FT   CDS_pept        complement(648179..648589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0817"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48325"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48325"
FT                   /db_xref="GOA:Q98LY8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LY8"
FT                   /protein_id="BAB48325.1"
FT                   /translation="MPDCEISFDLARIDFRATSDLLMASYWGTGRSDEFHHRAFANSLC
FT                   AAAYIDGKQVGFGRAITDRTVFAYLADIIVWPQNRGQGIGQRLVQALIDHPELGSVSHW
FT                   SLSTGDAHGVYEKLGFKASTDGRYMRLDRAVQ"
     atgccggact gtgagatcag cttcgacctc gcgcggatcg actttcgcgc gacctccgac        60
     ctgttgatgg cgagctattg ggggactgga cgcagcgatg agtttcatca ccgggccttc       120
     gccaattcgc tctgcgccgc cgcctacatc gatggcaagc aggtcggttt cggcagggcg       180
     atcaccgacc gcacggtgtt cgcctatctc gccgacatca tcgtctggcc gcagaatcgc       240
     gggcagggca tcggccagcg gctggtgcag gcactcatcg atcatcccga gctcggcagc       300
     gtctcgcact ggagcctgtc gaccggtgat gcgcatgggg tctacgaaaa gctgggcttt       360
     aaggcatcga ccgacggccg atacatgcgc ctggaccgcg cggtccagtg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page