(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0824

BA000012.MLL0824     Location/Qualifiers
FT   CDS_pept        complement(652839..653255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0824"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48331"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48331"
FT                   /db_xref="GOA:Q98LY2"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LY2"
FT                   /protein_id="BAB48331.1"
FT                   /translation="MSDSHQGSCLCGAVRFRTKGALRGVVYCHCSQCRKQSGHFYAATN
FT                   VADADIVIEGTESITWYEASAFAGRGFCKTCGSVLFWKPRTQDYISVMAGAFDKPTGLK
FT                   GDCHIFVGDKGDYYSIDDGLPQFEKSTPSIAVAE"
     atgagcgata gtcaccaggg atcatgcctg tgcggcgcgg tccgcttccg gacaaaggga        60
     gcattgcgcg gcgtcgtcta ctgtcattgc tcgcaatgca ggaagcaaag cgggcatttc       120
     tatgccgcga ccaacgtcgc cgacgccgac atcgtaatcg aaggcacgga aagcatcacc       180
     tggtatgaag cgtccgcttt cgccgggcgc ggcttctgca agacatgcgg gtccgtactt       240
     ttctggaagc caaggactca agactatatt tcggtcatgg cgggagcgtt cgacaagccg       300
     acaggtctca agggcgactg tcatatcttc gtcggcgaca agggcgacta ttattcgatc       360
     gacgacgggc tgccgcagtt tgaaaagtcg acgccttcga tagcggtcgc tgaatga          417
//

If you have problems or comments...

PBIL Back to PBIL home page