(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0838

BA000012.MLL0838     Location/Qualifiers
FT   CDS_pept        complement(667211..667957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0838"
FT                   /product="c-type cytochrome biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48342"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48342"
FT                   /db_xref="GOA:Q98LX1"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LX1"
FT                   /protein_id="BAB48342.1"
FT                   /translation="MALDIGYVSAVGAGAISFLSPCVLPLVPPYLCYMAGVSVDDFRGD
FT                   AGVTAREGTRGALLYSSIAFVLGFSTVFVALGAGASTIGRLLRVWQEPLAMGAGVLIIL
FT                   MGLNFLGILRIPLLSREARFQSQGKPANAIAAYIMGLAFAFGWTPCIGPVLGPILTLAG
FT                   GRETVGEGALLLAAYSLGLGIPFLIAAVFSGAFMRFLGKFRVHLGRVEKAIGALLVVAG
FT                   VFFLTGGVQTVSYWLLENFPVLGRLG"
     atggcattgg acatcggcta tgtcagcgcc gtcggggcgg gagccatctc gttcctgtcg        60
     ccttgcgtgc tgccgctggt gccgccctat ctctgctaca tggcaggcgt ttcggtcgac       120
     gacttccgtg gcgatgcggg cgtcacagcc cgcgaaggca cgcgcggggc actgctctat       180
     tcttccatcg ccttcgtgct cggcttttcg accgtgttcg tcgcgctcgg cgccggcgcc       240
     tcgacaatcg gccggctctt gcgcgtctgg caggagccgc tggcgatggg cgccggcgtg       300
     ctgatcatcc tgatgggcct gaatttcctc ggcatattgc gcattccgct gctgtcgcgc       360
     gaggctcgtt tccagtcgca aggcaagccg gcaaatgcta tcgccgcgta tatcatgggg       420
     ctcgccttcg ccttcggctg gacgccctgc atcggcccgg tgctggggcc gatcctgacg       480
     ctggccggcg ggcgcgagac ggtgggcgag ggtgcgctgc tgctcgccgc ttattcgctc       540
     ggacttggaa taccgtttct gatcgccgcc gtgttttctg gcgccttcat gcgcttcctc       600
     ggcaaattcc gcgtccatct cggccgcgtt gaaaaggcga tcggcgctct gctggtagtc       660
     gccggcgtgt ttttcctaac cggcggcgtg cagaccgtgt cctactggct gctggagaat       720
     tttccggtgc tgggtcggct ggggtaa                                           747
//

If you have problems or comments...

PBIL Back to PBIL home page