(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0849

BA000012.MLL0849     Location/Qualifiers
FT   CDS_pept        complement(677824..678891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0849"
FT                   /product="ATP-binding protein of sugar ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48350"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48350"
FT                   /db_xref="GOA:Q98LW3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LW3"
FT                   /protein_id="BAB48350.1"
FT                   /translation="MASVTLDKVRKDYGAVRVLHAVDLEIADGEFVVLVGPSGCGKSTL
FT                   LRMIAGLEEASGGEIRIGERLVNDVAPKDRDIAMVFQSYALYPHMDVSKNMGFSLLLKK
FT                   AQKSTIDARVDGAAKRLGLDTFLQRLPRQLSGGQRQRVAMGRAIVRDPKVFLFDEPLSN
FT                   LDAKLRVHMRAEIKALHQQLKTTSVYVTHDQIEAMTMADRIVVMHDGLIQQVGAPLDLY
FT                   DRPANVFVAGFIGSPGMNFLPATVEKGAKADAVLSDGQKLRLPDGLPLKDGDAITIGLR
FT                   PEHIRLAEDGALQGEVVVVEPLGLSTQFYVTLANQQLCVFAMGRAGVKPGDIVRLAADP
FT                   AALHLFDPKSGDRIG"
     atggcttctg ttacactcga taaggtccgc aaggactatg gcgccgtccg cgtcctgcac        60
     gcggtcgatc ttgaaatcgc cgatggcgag ttcgtcgtcc tggtcgggcc gtctggctgc       120
     ggcaaatcca cgcttttgcg catgatcgcc gggctggagg aggcttcagg cggcgagatc       180
     cgcatcggcg agcggttggt caatgacgtc gcgcccaagg accgcgacat cgccatggtg       240
     ttccagtcct acgcgctcta cccgcatatg gacgtgtcga agaacatggg cttcagcctg       300
     ctcctgaaga aggcgcagaa gtccacgatc gatgcaaggg tggatggcgc ggccaagcgg       360
     ctcgggctcg acacgttcct gcaacggttg ccgcggcaat tgtccggcgg ccagcgacag       420
     cgcgtcgcca tgggacgcgc catcgtgcgc gaccccaagg tttttctctt tgacgagccg       480
     ttgtcgaatc tcgacgccaa gttgcgcgtg catatgcgtg ccgagatcaa ggcgttgcac       540
     cagcagttga agaccacctc tgtctacgtc acccacgacc agatcgaagc gatgaccatg       600
     gccgaccgga tcgtcgtcat gcatgacggg ctgatccagc aggtcggcgc gccactcgat       660
     ctctatgacc ggccagccaa cgtgttcgtt gccggcttca tcggctcacc gggcatgaat       720
     ttcctgccgg caaccgtgga gaagggcgca aaggcggacg cggtgctttc cgatggccag       780
     aagctgcggc tgccggatgg cctaccactc aaggatggcg acgcgatcac catcggcctg       840
     cggcccgaac atataaggct ggccgaagac ggcgcactgc agggcgaggt ggtggtggtg       900
     gagccgctcg ggctttcgac gcagttctac gtcacactgg ccaaccagca gctctgcgtc       960
     tttgccatgg ggcgcgccgg cgtgaagccc ggcgatatcg tgcggctggc ggccgatccg      1020
     gcggcgctgc atctgttcga tccgaaaagc ggcgaccgca tcggctga                   1068
//

If you have problems or comments...

PBIL Back to PBIL home page