(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0859

BA000012.MLL0859     Location/Qualifiers
FT   CDS_pept        complement(686216..687442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0859"
FT                   /product="response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48357"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48357"
FT                   /db_xref="GOA:Q98LV6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LV6"
FT                   /protein_id="BAB48357.1"
FT                   /translation="MLLDVMMPDMDGFEVCRRLKSDPATSHIPVVMITALDQVSDRVRG
FT                   LEAGADDFLTKPVNDLQLMTRVKSLVRLKSLTDELRLRASTTRNIGIEELLSRNFASED
FT                   TTPKVLLIDERKSSVERIQKMLRDRADLDVIGDPHAGFFQAAETSYECVMISTAFADFD
FT                   PLRLCSQLRSLDRTRFVPIILLAEEGEEERIIRGLELGINDYLMRPIDQQELTARLRTQ
FT                   VRRKRYNDQLRASVTQTIEMAVTDGLTGLHNRRYLDSHLQTLFDRAVARRRPLSVMITD
FT                   LDRFKSINDAHGHDGGDEVLREFARRLRKNVRGIDLACRFGGEEFVVVMPDTDGAVAEK
FT                   VAERIRAEIAQKPFAIGADGKTIEVTVSVGVSSVLKGVDTVAALMKRADLALYEAKSGG
FT                   RNRVVAKAA"
     gtgctgctcg acgtgatgat gcccgacatg gacgggttcg aggtctgccg caggctgaag        60
     agcgacccgg cgacatcgca cattccggtg gtgatgatca ccgcgctcga ccaggtttcc       120
     gaccgcgtgc gcgggctcga ggccggcgcc gacgatttcc tgaccaagcc ggtcaacgac       180
     ctgcagctga tgacgcgcgt caagagcctg gtccggttga agtctctcac cgacgaactc       240
     aggctgcgcg cctcgacgac gcgcaacatc ggcatcgaag agctgctcag ccgcaatttc       300
     gcgtccgagg acacgacgcc gaaagtgctg ttgatcgacg agcgcaaatc gtctgtcgag       360
     cgcatccaga aaatgctgcg cgaccgcgcc gacctcgatg ttatcggcga cccgcatgcc       420
     gggttcttcc aggccgccga gacgtcctat gaatgcgtga tgatctcgac ggccttcgcc       480
     gatttcgatc cgctgcggct ctgctcgcaa ttgcgctcgc tcgaccggac ccgtttcgtg       540
     ccgatcatcc ttttggcgga ggagggcgag gaggagcgca tcatccgcgg cctcgaactc       600
     ggcatcaacg actatctgat gcggccgatc gaccagcagg agctgaccgc gcggctgcgc       660
     acccaggtgc gccgcaagcg ctacaacgac caattgcgcg ccagtgtcac ccagaccatc       720
     gagatggcgg tgaccgacgg cctgaccggg ctgcacaacc gccgctatct cgacagccat       780
     ttgcagacgc tgttcgatcg cgccgtggcg cggcgccggc cattgtcagt aatgatcacc       840
     gatctcgacc gcttcaagtc gatcaatgac gcgcatggcc atgatggcgg cgacgaggtg       900
     ctacgggaat tcgcgcggcg gctgcgcaag aatgtcaggg gtatcgacct tgcctgccgg       960
     ttcggcggcg aggagttcgt cgtggtcatg ccggacaccg acggtgccgt ggccgagaaa      1020
     gtggccgaac gcatccgcgc cgaaatcgct caaaagcctt tcgccatcgg cgccgacggc      1080
     aagacaatcg aggtcaccgt cagcgtcggg gtgtcgtcgg tgctgaaggg cgttgatacg      1140
     gtggcggcgc tgatgaagcg cgccgatctc gcgctctacg aagccaagag cggcggccgc      1200
     aaccgcgtcg tagccaaggc agcgtaa                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page