(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0865

BA000012.MLL0865     Location/Qualifiers
FT   CDS_pept        complement(689256..690923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0865"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48361"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48361"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LV2"
FT                   /protein_id="BAB48361.1"
FT                   /translation="MMVFAYQKYETIFAFSIQRRLPVNRMLPVAFTALLFSAPAFGQAV
FT                   DSQGAKQLSDDLSRYVGKQAFDKGILKVSVEGGAYKIAFDVKALAATFPEQGKVKLDFA
FT                   PYALLVKPRSDGTWDVSIDFSQSGSFEFTGPEGLQSTQFSIKDGKGSGVYDPNLAAFIS
FT                   GTSSLAGMTMASKDAKQQMEASTGAGTATIAATKAANGGVDFTMSQKISNFVEAIKLDD
FT                   PENGLNFPVTIKSPELSVEASGKGVQTRPLLDLLAFAVANEDEKTLEANQAQLKSLLRA
FT                   ALPVWERIDGTYGFKDFAVDSPIGTFGATQLSTVFGSDGVSQSGKVTYGIKASGLTVPQ
FT                   QLLPSWSVALLPTDIDLNFGGANIDLDSMAKKAIEAFDLNQDPPLSAEFGDQLKADFLA
FT                   KAPKVMIGHSVVKNKDMEIALEGEMTSFGQKPDANLTVDVAGFDKIMAHLQEAAKAEPE
FT                   VGQYVPVALMAKGFAKTLPDGRLEWAVSTKADGSVTVNGVMLKPADPAVDDGGDGGDGG
FT                   DGADDSSGGDNGGGANSGGGDANGGSSDNGGAGAKLNP"
     gtgatggtat ttgcctacca gaagtatgaa acgatttttg ccttttcgat ccaacggaga        60
     cttcccgtga accgtatgtt gccagttgcc tttaccgcgc ttctgttcag cgcgcccgct       120
     ttcggccagg ccgtcgacag ccagggcgcc aagcaattgt ccgatgacct gtcacgctat       180
     gtcggcaaac aggcgttcga caagggcatt ctgaaggttt cggtcgaagg cggcgcctac       240
     aagatcgcgt tcgatgtcaa ggcgcttgcc gcgacgtttc ccgagcaggg aaaggtgaaa       300
     ctcgacttcg ctccctacgc cctgctggtg aagccgcgca gcgacgggac ctgggatgtc       360
     tcgatagatt tttcgcaaag cggatccttc gagttcaccg ggcccgaggg gctgcaaagc       420
     acacagtttt cgatcaagga cggcaagggt tccggcgtct acgatcccaa tctggcggcc       480
     ttcatcagcg gcaccagttc gctggccggc atgacgatgg catcgaagga cgccaagcag       540
     cagatggagg ccagcactgg cgccggcacc gcgaccatcg ccgccaccaa ggctgccaat       600
     ggcggcgtcg atttcacgat gtcgcagaag atttcgaatt tcgtcgaggc gatcaaactg       660
     gacgatcccg agaacgggct gaattttccg gtcaccatca agtcgccgga actgtcggtg       720
     gaagccagcg gcaagggcgt gcagacaagg ccgctgctcg acctcctggc atttgccgtg       780
     gccaatgagg acgagaagac gctggaggcc aaccaggcgc agctcaagtc gcttctacgc       840
     gctgcgctgc cggtgtggga gcgcatcgac ggcacctatg gcttcaagga tttcgcggtc       900
     gacagcccga tcggtacttt cggggcaacc cagctcagca ccgtgttcgg cagcgacggc       960
     gtttcccaga gcggcaaggt cacctacggc atcaaagcgt cggggctgac cgtgccgcag      1020
     cagcttttgc cgagctggag cgtggcgttg ctgcccaccg atatcgacct gaacttcggt      1080
     ggtgccaata tcgatctcga cagcatggcg aagaaggcga tcgaagcctt tgatctcaat      1140
     caggatccgc cgctgtcggc cgagttcggc gaccagctca aagccgactt tctcgccaag      1200
     gcgccgaagg tcatgatcgg ccacagcgtt gtgaagaaca aggacatgga gatcgcgctg      1260
     gaaggcgaga tgacgagctt cggccagaaa cccgatgcaa atctcaccgt cgatgtcgcc      1320
     ggcttcgaca agatcatggc acatctgcag gaagcggcaa aggcggagcc ggaggtcggg      1380
     cagtatgtgc ctgtcgccct catggccaag ggttttgcca agacgctgcc ggacggccgg      1440
     ctggaatggg ccgtcagcac caaggccgac ggctcggtca ccgtcaacgg cgtcatgctg      1500
     aagcccgccg atccggcggt ggacgacggc ggcgatggcg gtgacggcgg tgacggcgcg      1560
     gacgacagca gcggcggtga caatggcggc ggcgccaata gtggcggtgg cgacgccaat      1620
     ggtggtagca gcgacaatgg cggagccggt gcgaagctga acccttga                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page