(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0893

BA000012.MLL0893     Location/Qualifiers
FT   CDS_pept        complement(716919..717836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0893"
FT                   /product="probable integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48382"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48382"
FT                   /db_xref="GOA:Q98LT1"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LT1"
FT                   /protein_id="BAB48382.1"
FT                   /translation="MPVAILLLVLGSVAVAWPMVAAKGDRNDVKRRLKVDHGAMAAKPE
FT                   PPQKKNANVVRERAVKRAQEFYAKSDPENVARLRMKLIQAGYMEPRAVGTFFIIRFSAL
FT                   VGGAIGAFVLNQWLASAEATMTSRWAFVILSGVAGYFLPGLVLTQQVREKMREYRNGFP
FT                   DFMDLMIVCSDAGMSMEAGIERVSKELAKTYPALSQNLQLVSLELRAGRSLDDALKALA
FT                   DRLSLDEVRSFATLLQQSKELGTSLSGALRVFSDEMRHKRMSLAEEKAHALPAKMSIPV
FT                   TVCILPVVLMIAIIPIIVKMTGSH"
     atgccggtgg cgatcctgct tttggtcctg ggcagcgtcg cggtcgcctg gccgatggtg        60
     gcggcgaagg gcgaccgcaa cgacgtgaag cgccggctca aggtcgacca tggcgccatg       120
     gccgcgaagc ccgagccgcc gcagaagaag aacgccaatg tcgtgcgcga aagggcggtg       180
     aagcgggcgc aggaattcta cgccaagagc gatccggaaa atgtcgcccg gttgcgcatg       240
     aagctgatcc aggccggcta tatggagccg cgcgccgtcg gcacgttctt catcattcgc       300
     ttttcggcgc tggtcggcgg cgcgataggc gcctttgtcc tcaaccagtg gctggccagt       360
     gccgaagcga cgatgaccag ccgctgggcg ttcgtcatcc tgtcgggcgt ggccggctat       420
     ttcctgcccg gcctggtgct gacccagcag gtgcgggaaa agatgcgcga ataccgcaac       480
     ggctttcccg acttcatgga tctgatgatc gtctgttcgg atgccggcat gagcatggaa       540
     gccggtatcg agcgcgtctc gaaggaactc gcaaagacct atcccgcgct cagccagaat       600
     ttgcagcttg tgtcgctgga actgagggca gggcgcagcc tcgacgatgc gctgaaggca       660
     ctcgccgacc gcctcagcct ggacgaagtt cgctccttcg ccacgctgct gcagcagtcg       720
     aaggaactcg gcaccagcct gtcaggcgcg ttgcgcgtct tctccgacga aatgcgccac       780
     aagcgcatgt cgctggccga ggaaaaggca catgccttgc cggccaagat gtcgataccg       840
     gtgacggtat gcatcctgcc ggtggtgctg atgatcgcga tcattccgat catcgtcaaa       900
     atgacgggta gccattag                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page