(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0894

BA000012.MLL0894     Location/Qualifiers
FT   CDS_pept        complement(717886..718791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0894"
FT                   /product="probable integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48383"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48383"
FT                   /db_xref="GOA:Q98LT0"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LT0"
FT                   /protein_id="BAB48383.1"
FT                   /translation="MIAEACYLLYAGRSDKRTAINRRMKLQESKISQEQVLIQLRKERG
FT                   LDAGTSLFSPDRFRALRTQSGMIMPLSKFLMITSGVAMAMTLVAIWHGLPLLMGLLLFV
FT                   VLMPLVPVMVMRSKRKRRLKRFGMQLPEALELITRGLKAGHPVPVAIAMVSREMPDPIG
FT                   TEFGVIADEVTYGSDLVSALNSLFDRVGHEDLPLFITAVSIQSSSGGNLREILDGLALT
FT                   IRERGKLRRKVRAISTEGRMSAYILTAIPALLFAAIMALMPGFYRDVWDEPKTWYLIGG
FT                   SVTWLMLGNLMMFKMSNFRF"
     atgatcgccg aggcctgcta tctcctctat gccggccgca gcgacaagcg caccgccatc        60
     aaccgacgca tgaagctgca ggaaagcaag atcagccagg agcaggtgct gatccaactg       120
     cgcaaggagc gcggcctcga cgcgggcacc tcgttgttct cgccggaccg gttccgcgcg       180
     ctgcgcacgc agtcgggcat gatcatgccg ctgtcgaaat tcctgatgat cacctccggc       240
     gtggcgatgg ccatgaccct ggtcgccata tggcatggct tgccgctgct gatggggctt       300
     ctcctgttcg tagtgctgat gccgctggtg ccggtgatgg tgatgcgctc caagcgcaag       360
     cgccggctca agcgcttcgg catgcagcta cccgaggcgc tggagctgat cacgcgcggc       420
     ctcaaggccg gtcaccccgt gccggtggca atcgccatgg tgtcgcgcga aatgcccgat       480
     ccgatcggca ccgagttcgg cgtcatcgcc gatgaggtga cctatggctc cgacctggtc       540
     tcggcgttga attcgctgtt cgacagggtc ggccatgagg atctgccgct gttcatcacc       600
     gccgtctcca tccagtccag ttcgggcggc aatttgcgcg agatcctcga cggccttgca       660
     ttgacgatcc gcgagcgcgg caagctgcgc cgcaaggtgc gcgccatctc gaccgaaggc       720
     cgcatgtcgg cctacatcct gacggcgata ccggcgctgc tgtttgccgc catcatggcg       780
     ctgatgccgg gcttctaccg cgatgtctgg gacgagccga agacctggta cctgatcggc       840
     gggtcggtga cctggctgat gctgggcaat ctgatgatgt tcaaaatgtc gaatttcagg       900
     ttctga                                                                  906
//

If you have problems or comments...

PBIL Back to PBIL home page