(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0904

BA000012.MLL0904     Location/Qualifiers
FT   CDS_pept        complement(727485..729701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0904"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48391"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48391"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LS2"
FT                   /protein_id="BAB48391.1"
FT                   /translation="MDLYGKSVRARRRGQCAGPGLCQFRIAVRGPLRGGSGADAAARRC
FT                   FVKGAVGDGRSALHEPSRAAADHQRTGLRPARSRRCRAGAFAAAYRCRSDQPRGGESEG
FT                   DAEADRRPSCRLDGAVGGDRRDRRGGSLRGAARQQRRRHRFSELPPHGRTPWASAAGAR
FT                   GADIGHQAACRLPAHAADQARRDVEDIAAGHGIDGRRAGRSRPAGRLRQGLGDTDRGHA
FT                   PGRTCRADRASQAARRPHCELPHPHHRAWQGRFLRLHAGRTRPAVRTAGEGAAGRRPRR
FT                   GLAGIVPQRGPGRGNACDHPACLENLAGGRQWQAHRRRAGSQLADAQGVGRAIRGRRSR
FT                   GPGQVDPSRRAARERAGSRAGHCGGLGFIPREKIGKILHRGGNDAQGCRDLQHVAGGVS
FT                   LGDARRVLPGDSNGGCLRIAGGAEQQFARQPSQEIGDRKCGFGRDGMVLARAAQPQDLQ
FT                   ADRDGGDAAAQHRITLPAGILHQRHQLVDAVIGEAFEGRTPRHALVQAKPCQILAHGPY
FT                   DPVRREPRIGGQHDNEDADRQQNAYQNGRRAGEERARIVGHRLMRAEESEEVDGEGRGY
FT                   ADIARIGHAQRRRHQDRHNEQHEPAEAGQSRQCDLADEKGKGQSQQRALEEAPGHLHRI
FT                   GASGEKAGYDGNENDRARRLGPFRRQPEGRDQQGGKGGTHGIARCAGVVAVHHQRRLPA
FT                   GAAGTCDRRAQGIEPAQHLLERLGEIGGDGEAGDGADPVVTLVD"
     atggatctat acggcaagag tgtccgagcg cgccgccgcg gccaatgcgc tggcccgggc        60
     ctatgtcaat tccgaattgc cgttcgagga ccgctgcgcg gcggaagcgg cgctgacgct       120
     gctgctcgac gatgcttcgt caaaggtgcg gttggcgatg gccgaagcgc tctccatgag       180
     ccatcacgcg ccgctgcaga tcatcagcgc actggcctcc gaccagccag aagtcgccgg       240
     tgtcgtgctg gcgcgttcgc cgctgcttac cgatgccgat ctgatcaacc gcgtggcggc       300
     gagtcagaag gcgacgcaga agctgatcgc cgaccgtcct gtcgtctcga tggcgctgtc       360
     ggcggcgatc gccgagatcg gcgaggcgga agcctgcgcg gtgctgctcg ccaacagcgg       420
     cgccgacatc gcttctctga gcttccgccg catggccgaa cgccatgggc atctgccgca       480
     ggtgcgcgag gcgctgatat tggacatcag gctgcctgcc gactgccggc acatgctgct       540
     gatcaagctc ggcgagacgt tgaagacatc gccgctggtc atggcattga tgggcgccgc       600
     gcgggccgat cgcgtcctgc gggacgcctg cgtcaaggcc tcggtgacac tgatcgaggg       660
     cacgcgccag gaagaacatg ccgcgctgat cgagcatctc aggctgcgcg gcgacctcac       720
     tgcgagcttc ctcatccgca ccatcgcgca tggcaaggtc gatttcttcg gctccacgct       780
     ggtcgcactc gcccagcagt ccgaaccgcg ggtgagggcg ctgctggccg gcggccacga       840
     cgtggccttg caggcattgt tccgcagcgc gggcctggcc gcggcaacgc atgcgatcat       900
     cctgcgtgcc ttgaaaatct ggcgggaggt cgccaatggc aagcgcatcg ccggcgtgca       960
     ggaagtcagc tggctgatgc tcaaggagtt gggcgggcaa tccgcggaag gcgatctcgc      1020
     ggccctggtc aagtcgatcc atctcgacgc gctgcgcgag aacgcgcggg gtcacgcgct      1080
     ggccattgcg gcggcctagg ctttatccct cgcgaaaaaa tcgggaaaat cctccatcgc      1140
     ggcggcaatg atgcgcaggg atgccgcgat ctgcagcatg tcgccggggg cgtttcgctg      1200
     ggcgatgctc gccgcgtact gccgggcgac agcaatggtg gctgtctgcg gatcgccggg      1260
     ggcgcggaac agcagttcgc gcgccagccc tctcaggaaa ttggcgatcg aaagtgcggt      1320
     ttcggacggg atggcatggt tttggctcgc gccgcgcagc cgcaggatct ccaggccgac      1380
     cgtgacggcg gcgacgccgc cgcccagcac cgcatcaccc ttcctgccgg aattctgcac      1440
     cagcggcatc agctggttga tgcggtcata ggcgaggctt tcgaaggccg aacgcctcgg      1500
     cacgcgctcg tgcaggcaaa gccgtgccaa atcctcgcgc atggcccgta cgatccggtt      1560
     cgccgcgagc cacggatcgg cgggcagcac gacaatgaag acgccgatcg ccagcagaat      1620
     gcctaccaga acggacgccg agccggcgaa gaacgggcca ggatcgtagg tcatcgcctg      1680
     atgcgggctg aggaaagcga ggaagttgat ggcgaaggcc gtggctatgc cgacatagcg      1740
     cggattggcc atgcccagcg ccgtcggcac caggatcggc acaacgaaca gcacgaacca      1800
     gccgaagccg ggcaaagcag gcaatgcgat ctggccgatg agaaaggcaa agggcaaagc      1860
     cagcagcgtg cccttgaaga agccccagga cacctgcacc ggatcggggc gagcggcgaa      1920
     aaggctggat acgacggcaa cgagaatgac cgtgcccgcc gcctcggacc atttcgtcgt      1980
     cagccagaag gccgcgacca gcagggtggc aagggcggca cgcacggcat tgcgcgatgc      2040
     gccggggtag tcgcggtgca ccaccagcgc aggctgcctg ccggcgcggc cggtacctgt      2100
     gaccggcgcg cgcaaggcat cgagcccgcg cagcacctgc ttgagcgcct cggcgaaatc      2160
     ggcggcgatg gtgaggcggg tgatggtgcc gaccctgtcg tcaccctggt cgattga         2217
//

If you have problems or comments...

PBIL Back to PBIL home page