(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0907

BA000012.MLL0907     Location/Qualifiers
FT   CDS_pept        complement(731234..733135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0907"
FT                   /product="probable secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48394"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48394"
FT                   /db_xref="GOA:Q98LR9"
FT                   /db_xref="InterPro:IPR010420"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LR9"
FT                   /protein_id="BAB48394.1"
FT                   /translation="MKKRDSLGTRLRYGFDKSMAAGPIALIGWLAVVSLLIIIAAAAFL
FT                   AVTRIAPEGGEPLNFFEAFWESLMRTLDSGTMGGDTGWAFRLVMLVVTLAGIFVVSALI
FT                   GVLSAGVDGKLDELRKGRSRVLESDHTIILNWSPSIFDVISELVIANASRRRPRIVVMA
FT                   NMDKVAMEDEIAAKVGKLGNTRIICRSGDPTDLYDLAIVNPQTSRSVIVLSPDGDDPDS
FT                   QVIKTVLALVNDPSRRTDPYNIAAEIRDGKNAEVARVVGGAEVQLVLADQLISRIVVHS
FT                   SRQSGLSGVYSELLDFDGCEIYTTTQPELAGKTFGEAVMAYEHCALIGLCDQGGRVNLN
FT                   PPSELVIGKDMRAIIIAEDDAAIRPGSAGIKIDTAAIRDPRPVEAKPERTLILGWNRRG
FT                   PIITYELSRYVAPGSILTIAADTPGLEQEVAGLPVAGDNLSVSCRITDTSSSTALSSLD
FT                   VPSYDHVLVLGYSETMAAQPADTRTLVTLLHLRKIADDAGLHISIVSEMIDVRNRELAA
FT                   VTKADDFVVSNRLVSLMLAQASENQYLAAIFDDLLDEQGSEIYMRPVADYVAIDQPLTF
FT                   WTIAESARLRGEIAIGYRRIRAGDADQRALGGVTVNPLKSEALTYLPEDRIIVLARD"
     atgaagaaac gagactcgct gggaacccgg ctgcgctacg gcttcgacaa gagcatggcc        60
     gccggcccga tcgcgctgat cggctggctt gccgtcgttt ccctgctgat catcatcgcc       120
     gccgccgctt tccttgcggt gacccgcatc gcgccggaag gcggcgagcc gctgaatttc       180
     ttcgaagcgt tctgggaatc gctgatgcgc acgctcgatt ccgggacgat gggcggtgac       240
     accggctggg ccttccgcct cgtcatgctg gtcgtcacgc ttgccggcat cttcgtcgtg       300
     tccgccctca tcggcgtgct cagcgccggc gtcgacggca agctcgatga attgcgcaag       360
     ggccgttctc gggtgctgga gagcgaccac acaatcatcc tcaactggtc gccgtcgatc       420
     ttcgacgtga tttccgaact cgtcatcgcc aatgccagcc gccgccgtcc gcgcatcgtc       480
     gtcatggcca atatggacaa ggtcgcgatg gaggacgaga tcgcggccaa ggtcggcaaa       540
     ctgggcaaca cgcgcatcat ctgccgcagc ggcgatccga ccgatctcta tgatctcgcc       600
     atcgtcaacc cgcagacctc gcggtcggtc atcgtgctgt cgccggacgg cgacgatccg       660
     gattcgcagg tcatcaagac ggtgctggcg ctggtcaacg acccgagccg gcgcaccgac       720
     ccctataaca tcgccgccga gatccgcgac ggcaagaatg ccgaggtcgc ccgcgtcgtc       780
     ggcggggccg aggtgcagct cgtgctggcc gatcagctga tctcgcgcat cgtcgtgcat       840
     tcgagccggc agtcgggcct cagcggcgtc tattcggaac tgctcgattt cgatggctgc       900
     gagatctaca cgaccacgca gccggagctc gccggcaaga ctttcggcga ggcggtgatg       960
     gcctatgagc attgcgcgct gatcgggctc tgcgaccagg ggggacgcgt caatctcaac      1020
     ccgccgtcgg agctggtgat cggcaaggac atgcgcgcca tcatcatcgc cgaggacgat      1080
     gccgcgatca ggcccggaag cgccgggatc aagatcgaca cggcggcgat ccgcgacccg      1140
     cggcccgtcg aggcgaagcc ggagcgcacg ctgatcctcg gctggaaccg gcgcggtccg      1200
     atcatcacct atgaactgtc gcgctacgtc gcgcctggtt cgatcctgac catcgccgcc      1260
     gatacgcctg gcctcgagca ggaagttgcc ggactgccgg tcgctggcga caatctgtcg      1320
     gtttcctgcc gcatcaccga cacgtcgagc agcacggcgc tttcaagcct ggacgtgcct      1380
     tcctacgacc acgtgctggt cctcggctac agcgaaacca tggccgcgca gccggccgac      1440
     acgcgcacgc tggtgacgct gctgcatctg cgcaagatcg ccgacgatgc cggcctgcac      1500
     atctccatcg tcagcgagat gatcgacgtg cgcaaccgcg agcttgcggc ggtgaccaag      1560
     gccgatgatt tcgtcgtcag caaccggctg gtcagcctga tgctggcgca ggcgtccgag      1620
     aaccagtatc tcgccgcgat cttcgatgat ttgctcgacg agcagggctc cgaaatctac      1680
     atgcgcccag tcgccgacta tgtcgccatc gaccagccct tgaccttctg gacgatcgcg      1740
     gagtcggcgc ggctgcgcgg cgagatcgcc attggctatc gacgcatccg cgccggagac      1800
     gccgaccagc gggctctggg cggcgtcacc gtcaatccgc tgaagtcgga agcgctgacc      1860
     tatctgccgg aggaccggat tatcgtcctg gcgcgggact ga                         1902
//

If you have problems or comments...

PBIL Back to PBIL home page