(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0909

BA000012.MLL0909     Location/Qualifiers
FT   CDS_pept        complement(733301..734035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0909"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48395"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48395"
FT                   /db_xref="GOA:Q98LR8"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LR8"
FT                   /protein_id="BAB48395.1"
FT                   /translation="MVDHWSISANIMGAQRGRSMMIAKLLLQTFIWFGVMGALLFLSAG
FT                   TFAWPAAWVYLVVMVGLSLTMGVALARRDPGLMNERLSAPIQKNQAAADKVLLSILLIG
FT                   IFGWLSFMGFDFRFGWSAVPFWAQAVGALVLLVGIWICYLTMLENSFAAPVVKIQDERG
FT                   QRVITTGPYSYVRHPMYAGAILFFAGTALLLGSWWGLVSVLVFIVLLAIRTFIEEKTLR
FT                   TGLRGYDDYATRVRYRLIPMVW"
     atggtagacc attggtctat ttcagccaat atcatgggag cacagcgcgg aaggtcgatg        60
     atgatcgcaa aattgcttct tcagacgttc atctggttcg gcgtcatggg cgccttgctg       120
     ttcctgtcgg cgggcacctt tgcctggccg gcagcctggg tctatctggt ggtgatggtg       180
     gggctcagcc tcaccatggg cgtggcgctg gcgcggcgcg atcccggcct gatgaatgag       240
     cggctgagtg ctccgatcca gaagaatcag gccgcggccg acaaggtcct cctctccata       300
     cttctcatcg gcatcttcgg ctggctgagc ttcatgggat tcgacttccg tttcggctgg       360
     tcggcggtcc ccttctgggc gcaggcggtc ggcgcgctgg tcctgctggt cggaatctgg       420
     atctgctacc tgaccatgct ggagaacagt ttcgccgcac ccgtggtgaa gatccaggac       480
     gagcgcggac agcgcgtgat caccacgggg ccctacagct acgtccgcca tccgatgtat       540
     gccggcgcca tcctcttctt cgccggcacg gcactcctgc ttggctcctg gtgggggctg       600
     gtatcggtgc tcgtgttcat cgttctcctg gctatccgca ccttcatcga ggagaaaacc       660
     ctgcgcaccg gcctgcgtgg ctatgacgac tacgcaaccc gggtccgcta tcgcctgatc       720
     ccgatggtct ggtaa                                                        735
//

If you have problems or comments...

PBIL Back to PBIL home page