(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0910

BA000012.MLL0910     Location/Qualifiers
FT   CDS_pept        complement(734844..735452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0910"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48397"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48397"
FT                   /db_xref="GOA:Q98LR6"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LR6"
FT                   /protein_id="BAB48397.1"
FT                   /translation="MFYEPSKGHGLPHDPSKAIVAPRPIGWISTLNGAGEINLAPYSFF
FT                   NAVSTRPFIVWFSSEGEKDSASFAQETGEFVANLVSRDLAEKMNYTSVNAPRGVNEFVY
FT                   ADLAMAPSRLVKPPRVAAAPAALECRVTEVFRPKALDGTLTSAVIVAGEVVGVHIDDAF
FT                   LKDGLFDITKAGNVARLGYMDYASVDEVFSMRRPHWGKE"
     atgttctacg aaccgtccaa ggggcacggg ctgccgcatg atccgtcgaa ggcgatcgtg        60
     gcgccgcggc cgatcggctg gatatcgacg ctgaatgggg caggcgagat caacctggcg       120
     ccatactcct tcttcaacgc cgtttcgacg cggcccttca tcgtctggtt ctcctcggag       180
     ggcgagaagg acagcgcctc ctttgcccag gagaccggcg agttcgttgc caatctggtc       240
     agccgcgatc ttgcggagaa gatgaattat acgtccgtca acgcgccgcg cggtgtcaac       300
     gagttcgtct atgccgatct cgccatggcg ccttcgcgtc tcgtgaagcc gccgcgcgtg       360
     gcggccgcgc ctgccgcgct ggaatgccgg gtgacggagg tgtttcgccc gaaggcgctg       420
     gacggaacct tgacgagcgc cgtcattgtc gccggtgagg tggtcggcgt gcacattgac       480
     gacgccttcc tgaaggacgg cctgttcgac atcaccaagg ccggcaatgt ggcccgtctt       540
     ggctatatgg actatgccag cgtcgacgaa gtcttttcga tgcgccggcc acactggggc       600
     aaggagtag                                                               609
//

If you have problems or comments...

PBIL Back to PBIL home page