(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0918

BA000012.MLL0918     Location/Qualifiers
FT   CDS_pept        complement(742347..742808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0918"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48404"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48404"
FT                   /db_xref="GOA:Q98LQ9"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98LQ9"
FT                   /protein_id="BAB48404.1"
FT                   /translation="MTAQRTRAGIAFSSRSSHLSHGKRDTETAVHDPHGHAHTVRPPGR
FT                   GRNWPGPWRKTPGRLLGTSFVRLYQLTLSGFVGNSCRHLPTCSEYAHEAIARHGLWAGG
FT                   WMGFFRVLRCGPFGTHGIDLVPEVLADRYVWFMPWRYWRIGRKRAETRA"
     atgacagcac agaggacgag ggcggggatt gcgttctcca gccgaagctc acatctatcg        60
     catgggaaac gcgatacgga gactgcggtg cacgacccgc atgggcatgc ccatactgtc       120
     aggccgccgg ggcgcggacg caactggccc ggcccgtggc gcaagacgcc tggccgtctc       180
     ctaggcacgt cgttcgtgcg cctctaccag ctgacgcttt ccggttttgt cggcaattcc       240
     tgccggcacc tgccgacctg ttccgaatac gcgcatgagg cgatcgcccg ccatggcctg       300
     tgggccggcg gctggatggg atttttccgg gtgctgcgct gcgggccttt cggcacgcat       360
     ggtatcgacc tggtgccgga agttctggcg gatcgttatg tctggttcat gccctggcgg       420
     tactggcgga tcggccgcaa gcgcgccgag acgcgggcat ga                          462
//

If you have problems or comments...

PBIL Back to PBIL home page