(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0929

BA000012.MLL0929     Location/Qualifiers
FT   CDS_pept        complement(750044..751027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0929"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48412"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48412"
FT                   /db_xref="GOA:Q98LQ1"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LQ1"
FT                   /protein_id="BAB48412.1"
FT                   /translation="MNVAQNIVAGLDRILTMELVRVTERAAVAAARLRGRGDEKAADQV
FT                   AVDAMRQELNRLAIKGTVVIGEGERDEAPMLYIGEEVGTGKGPAVDIALDPLEGTTICA
FT                   KNLPNALAVIAIAEKGSLLFAPDVYMDKIAIGPGYAEGVIDIDASPAENIASLARAKGV
FT                   AVSDITTCILDRPRHAKLIDAVRATGAAIRLIGDGDVAGVIHTTDPEETGIDLYLGTGG
FT                   APEGVLAAAALRCTGGQMQGRLILDTPEKVARAAKMGISDPKRIYHAEDMARGDVLFAA
FT                   TGVTDGNMLAGVKFGRTYITTHTIVLRSSSRTVREIKARHQDLDKF"
     atgaatgtgg cccagaacat cgtcgccggc cttgaccgga tactcaccat ggaactggtg        60
     cgcgtcaccg aaagggccgc cgtggcagcc gccaggctgc gcggccgtgg cgacgagaag       120
     gctgccgacc aggtcgcggt cgatgccatg cgccaggagc tcaaccgcct tgccatcaag       180
     ggcacggtgg tgatcggcga gggcgagcgc gacgaggcgc cgatgctcta tatcggcgag       240
     gaggtcggca ctggcaaagg accggccgtc gacatcgcgc tcgatccgct cgaaggcacg       300
     acgatctgcg ccaagaacct gcccaacgcg cttgccgtca tcgccatcgc cgagaagggc       360
     agcctgctgt tcgcgcccga cgtctatatg gacaagatcg ccatcggtcc gggctatgcc       420
     gaaggcgtca tcgatatcga cgcctcgcca gccgaaaaca tcgccagcct cgcccgggct       480
     aagggcgtcg cggtgtccga catcaccacc tgcatcctcg accgtccgcg ccacgccaag       540
     ctgatcgatg ccgtgcgcgc cacgggagcg gcgatccggc tgatcggtga cggcgatgtc       600
     gccggcgtca tccacaccac cgacccggag gaaaccggca tcgatctcta tctcggcact       660
     ggcggcgcgc cggaaggcgt gctggcggcg gcggcactgc gctgcaccgg cggccagatg       720
     cagggccggc tgatcctcga tacgccggaa aaggtcgcgc gcgccgccaa aatgggcatt       780
     tccgatccga agcggatcta tcacgcggaa gacatggcgc gcggcgacgt gctgttcgcg       840
     gccaccggcg tcaccgacgg caacatgctg gccggcgtca agttcggccg cacctacatc       900
     accacgcaca cgatcgtgct gcgctcctcg tcgcggaccg tgcgcgaaat caaggcccgg       960
     caccaggatc tggataagtt ctag                                              984
//

If you have problems or comments...

PBIL Back to PBIL home page