(data stored in ACNUC7421 zone)

EMBL: BA000012.MLL0948

BA000012.MLL0948     Location/Qualifiers
FT   CDS_pept        complement(762284..763510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mll0948"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB48426"
FT                   /db_xref="EnsemblGenomes-Tr:BAB48426"
FT                   /db_xref="GOA:Q98LN7"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="UniProtKB/TrEMBL:Q98LN7"
FT                   /protein_id="BAB48426.1"
FT                   /translation="MAFNRFTRIRLVATGIRRSTRANVATIFALSLPIVVGAAGFGVET
FT                   SYWYYNSLRLQATADAAAYAGALEQISGSDKPTIIAAATQSAATNGLGSGTIVVNTPPA
FT                   SGPNTAKKAVEVIVAQNINRMFTSIFTQGQVPEQARAVALITNASKACVLALDPSASQA
FT                   ALFSGNTSVKLIGCSVMSNSIASDAIKLQGSAGLQADCLISGGGVSLSNPVTTVCAAPI
FT                   TQALPAADPFADLPAPAASNPCQNDNKATLSPGTYCSGMTLKGNVTLSPGVYVVQGNLK
FT                   INANAAITGSGVTIFMSGSSSVSINGNASVKLSAPTSGAYSGVLFYGDRTGNSASSTFN
FT                   GTADSLLTGAIYFPKQQISYLGNFSGNNGCTQVVANTIQWSGNSTINQDCTSLGMRDIP
FT                   ATQSVALVE"
     atggctttca atcgcttcac ccgaattcgg ctcgttgcga ccggtatccg ccggagtaca        60
     agggcaaatg ttgccaccat cttcgccctc agcctgccga tcgtcgtcgg cgcggccggc       120
     ttcggtgtgg agacctccta ctggtactac aacagcctga gactgcaggc gacggccgat       180
     gccgcggcct atgccggcgc gcttgaacag atctcgggtt ccgacaagcc gacgataatc       240
     gcggcggcga cgcagtcggc agcgacgaac gggctgggct cgggcacgat cgtcgtcaac       300
     acgccgccag cgtccgggcc gaatacagcg aagaaagcgg tcgaggtcat cgtcgctcag       360
     aacatcaacc ggatgttcac ctcgatcttc acgcaaggtc aggtgcccga gcaggcgagg       420
     gcggtggccc tcatcaccaa cgcttcgaag gcctgcgtgc tcgcgctcga cccatccgct       480
     tcgcaggcgg cgctgttttc cggcaacacc agcgtcaagc tcatcggctg ctcggtcatg       540
     tccaattcga tcgcatcgga cgccatcaag cttcagggct cggcgggcct ccaggccgat       600
     tgcctgatat cggggggcgg tgtttctctc agcaatcccg ttacgaccgt ctgcgcggcc       660
     ccgataaccc aggcgctgcc tgccgccgat ccatttgccg acctgccggc cccagccgct       720
     tcgaacccct gccagaacga taacaaagcc acactgagtc caggcaccta ttgcagcggc       780
     atgacgctaa agggcaatgt cacgctctca cccggcgtct acgtcgtcca gggcaatctc       840
     aagataaacg ccaacgctgc catcacaggc agcggggtga cgatcttcat gtcgggcagt       900
     tcgtcggtca gcataaacgg caacgcgtcc gtgaagctca gcgcgccgac ttcgggcgcc       960
     tattcaggcg ttctgttcta tggcgacaga accggcaaca gcgcatccag caccttcaac      1020
     ggcacagccg actcgctgct gactggggcc atctacttcc cgaaacagca gatcagctat      1080
     ctcggcaact tctcgggcaa caacggctgc acccaagtcg tcgccaatac gatccaatgg      1140
     tctgggaatt caaccatcaa tcaggattgc acgagcctcg gaatgcgaga cattccggcc      1200
     acgcagtccg tggcactggt cgagtag                                          1227
//

If you have problems or comments...

PBIL Back to PBIL home page