(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0010

BA000012.MLR0010     Location/Qualifiers
FT   CDS_pept        8483..8815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0010"
FT                   /note="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47688"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47688"
FT                   /db_xref="GOA:Q98NS3"
FT                   /db_xref="InterPro:IPR011499"
FT                   /db_xref="InterPro:IPR014546"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NS3"
FT                   /protein_id="BAB47688.1"
FT                   /translation="MFNVLQELGTWLHQVFIKQFDAWILLGFVAQFFFTMRFVVQWLAS
FT                   EKAKRSVVPVAFWFFSLFGGGLLLIYAIQRQDPVFIAGQAMGMFIYIRNLWLIANERKA
FT                   AMTKVD"
     gtgtttaacg tgcttcagga actggggacc tggcttcacc aggtcttcat caagcaattc        60
     gatgcgtgga tcctgctcgg cttcgttgcg cagttcttct tcaccatgcg ctttgtcgtg       120
     caatggctcg cctcggaaaa ggccaagcgc agcgtcgtgc cggtcgcctt ctggttcttc       180
     tcgctgttcg gcggcggcct gctgctgatc tatgccatcc agcgccagga tccggtgttc       240
     atcgccggcc aggccatggg catgttcatc tacatcagaa atctctggct gatcgccaat       300
     gagcgcaagg cggcgatgac caaggtcgat tga                                    333
//

If you have problems or comments...

PBIL Back to PBIL home page