(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0030

BA000012.MLR0030     Location/Qualifiers
FT   CDS_pept        24004..25101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0030"
FT                   /product="recombination protein; RecA"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47705"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47705"
FT                   /db_xref="GOA:Q98NQ6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q98NQ6"
FT                   /protein_id="BAB47705.1"
FT                   /translation="MAQNSLRLVEDKAVDKSKALDAALSQIERAFGKGSIMRLGANEQV
FT                   VEIETVPTGSLGLDIALGVGGLPRGRIIEIYGPESSGKTTLALHTVAEAQKKGGICAFV
FT                   DAEHALDPVYARKLGVDLENLLISQPDTGEQALEICDTLVRSGAIDVLVVDSVAALTPR
FT                   AEIEGEMGDSLPGLQARLMSQALRKLTASISRSNTMVIFINQIRMKIGVMFGSPETTTG
FT                   GNALKFYASVRLDIRRIGSVKDRDEVVGNQTRVKVVKNKLAPPFKVVEFDIMYGEGVSK
FT                   TGELVDLGVKAGVVEKSGAWFSYNSQRLGQGRENAKLFLRDNPDTAREIELALRQNAGL
FT                   IAEKFLENGGSEGGDDGFEDEAGAM"
     atggctcaga attctttgcg gcttgtagag gataaggcag tggacaaatc aaaggctctg        60
     gatgcggcgc tgtcgcaaat cgagcgggct ttcggcaagg gctcgatcat gcggctcggc       120
     gcgaacgagc aggtcgtcga gatcgaaacc gtgccgaccg gctcgctcgg cctcgacatc       180
     gcgctcggcg tcggtggcct gccgcgcggc cgcatcatcg agatctacgg accggaaagc       240
     tcgggcaaga cgacgctggc cctccacacg gtggccgaag cccagaagaa gggcggcatc       300
     tgcgccttcg tcgacgccga acacgcgctc gatccggtct atgcccgcaa gctcggcgtc       360
     gaccttgaaa acctgctgat ctcgcagccc gataccggcg agcaggcgct ggagatctgc       420
     gacacgctgg tgcgttccgg cgccatcgac gtgctggtgg tcgattcggt cgcggcactg       480
     acgccgcgcg ccgaaatcga gggcgagatg ggcgattcgc tgcccggcct gcaggctcga       540
     ctgatgagcc aggcgctgcg caagctgacc gcctcgatct cgcgctccaa caccatggtc       600
     atcttcatca accagatccg catgaagatc ggcgtcatgt tcggttcgcc cgagaccacg       660
     accggcggca atgcgctgaa attctatgcg tcggtgcgcc tcgatatccg ccgcatcggc       720
     tcggtcaagg accgcgacga ggtcgttggc aaccagaccc gcgtcaaggt ggtcaagaac       780
     aagctggcgc cgcccttcaa ggtggtcgag ttcgacatca tgtatggcga gggcgtgtcc       840
     aagaccggcg aactggtcga cctcggcgtc aaggccggcg tggttgagaa atcgggcgcc       900
     tggttctcct acaattcgca acgtctcggc caggggcgcg aaaatgcaaa gctgttcctg       960
     cgcgacaatc ccgataccgc acgcgagatc gaactggcgc tcaggcagaa tgccgggctg      1020
     atcgccgaaa aattcctcga gaatggcggc tctgaaggcg gcgacgacgg ttttgaggac      1080
     gaagccggcg caatgtag                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page