(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0033

BA000012.MLR0033     Location/Qualifiers
FT   CDS_pept        28039..28395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0033"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47707"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47707"
FT                   /db_xref="GOA:Q98NQ4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NQ4"
FT                   /protein_id="BAB47707.1"
FT                   /translation="MNVLVLGGYGLIGDAVIGRLLRDGHHVTGLGRDVPDAGRRRPAVR
FT                   WIAADMSKLLAAEDWLPVVAGMDAVVKFGSAIWRGRRPSKTHRCPPKRNACFASGLLAV
FT                   FQPLARRLRSSGRW"
     atgaatgttc tcgtcctcgg tggctatggg ttgatcgggg acgccgtcat tggccgtttg        60
     cttcgcgacg gtcatcatgt gaccggcctc ggccgcgatg ttccggatgc tgggcggcgc       120
     cggccggcgg ttcgatggat cgcggcggac atgtcgaaac tgcttgccgc tgaagactgg       180
     ctgccggtgg ttgcgggcat ggacgcggtg gtcaaattcg gatccgcaat ctggcgcggc       240
     aggcggccat cgaaaacgca ccgctgcccg ccgaagagaa acgcctgttt cgcatctggt       300
     ttgcttgcgg ttttccagcc tttggcgcgg cgcttgcgat cctctggccg atggtga          357
//

If you have problems or comments...

PBIL Back to PBIL home page