(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0071

BA000012.MLR0071     Location/Qualifiers
FT   CDS_pept        50603..50923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0071"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47734"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47734"
FT                   /db_xref="InterPro:IPR009945"
FT                   /db_xref="InterPro:IPR038293"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NM7"
FT                   /protein_id="BAB47734.1"
FT                   /translation="MSSMKDREEGFERKFAFDEELRFKASARRNKALGLWAAEKLGKSG
FT                   ADADAYAKEVVVSDIEEAGDHDVFRKIRKDFDAAGVEQSDHQIRRTMDELMAQAIEQIK
FT                   NT"
     atgagcagca tgaaagatcg cgaagaaggc ttcgagcgca aatttgcatt cgacgaagag        60
     cttcggttca aggcgtcggc gcgccgcaac aaggcgctcg ggctgtgggc cgccgaaaag       120
     ctcggaaagt cgggtgccga cgccgacgcc tatgcgaagg aagtcgtcgt ttccgacatc       180
     gaggaagccg gcgatcacga cgtgttccgc aagatccgca aggatttcga tgccgccggt       240
     gtcgagcagt cggaccatca gatccgccgc accatggacg aactgatggc gcaggcgatc       300
     gagcagatca agaacacctg a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page