(data stored in ACNUC7421 zone)

EMBL: BA000012.MLR0078

BA000012.MLR0078     Location/Qualifiers
FT   CDS_pept        54043..54855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mlr0078"
FT                   /note="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:BAB47738"
FT                   /db_xref="EnsemblGenomes-Tr:BAB47738"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:Q98NM3"
FT                   /protein_id="BAB47738.1"
FT                   /translation="MSELPFAATTPVSVARVGLKARDAESLAAYYRRVVGLQELSRADG
FT                   AITLGAGSRPLLVLEPDASAKPDDPRSAGLFHTAFLLPSRADLGRWINHAISDKIAIEG
FT                   ASDHLVSEALYLTDPEGNGIEIYADRRPQDWKWNGDKIAMATERLNIPAVVGEVPVGDA
FT                   GWQGAPENSIVGHVHLRVGRPEEAEAWWNQEFGFDTVAKYGGQAVFLSSGHYHHHIGAN
FT                   AWQSAGAGRRDPSRSGLAWVEMRSDNVTGETTREDPWGTVIRTVPGKA"
     atgagcgaac tgccatttgc cgctaccacg ccggtgagcg ttgcccgcgt cgggttgaag        60
     gcgcgcgacg ccgaaagcct cgctgcctat taccgcaggg ttgtcggcct gcaggaattg       120
     agccgtgccg atggcgcgat caccctcggt gccggcagcc gtccgttgct ggtcctcgag       180
     ccggatgctt ccgccaagcc tgacgatccg cgcagcgccg gcctgttcca cacggccttc       240
     ctgctgccca gccgtgccga tctcggccgc tggatcaacc acgccatatc agacaagatc       300
     gccatcgagg gcgcgtccga ccatctggtc agcgaagcgc tctacctgac cgaccccgaa       360
     ggcaacggca tcgagatcta tgccgaccgc cggccgcagg actggaagtg gaacggcgac       420
     aagatcgcca tggcgaccga gcggctcaac attccggctg tcgtcggcga agtaccggtc       480
     ggcgatgcag gctggcaagg cgcgccggaa aacagcattg tcggccatgt ccatcttcgt       540
     gtcggcaggc cggaagaggc ggaagcctgg tggaaccagg aattcggctt cgacacggtg       600
     gccaaatatg gcggtcaggc agtgttcctg tcgtcgggcc attaccatca tcacatcggc       660
     gccaatgcct ggcagagcgc cggcgccggc cgtcgcgacc cgtcgcgttc gggcctcgcc       720
     tgggtcgaga tgcgttcgga caatgtgacc ggcgaaacga cccgtgagga tccttggggc       780
     acggtgatca ggaccgttcc gggaaaggcg tga                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page